Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate GFF2780 HP15_2724 short-chain dehydrogenase/reductase SDR
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >FitnessBrowser__Marino:GFF2780 Length = 286 Score = 105 bits (263), Expect = 8e-28 Identities = 84/269 (31%), Positives = 128/269 (47%), Gaps = 21/269 (7%) Query: 7 LKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKH----QSSGNYNFWPTDISS 62 L K +TG A GIG AI + QGA V + DI S + ++ D+S Sbjct: 23 LDGKTALITGAARGIGEAIAIQFAEQGATVIVSDIDDQMGQALVDSSKLDMHYLHLDVSD 82 Query: 63 ASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNINQKG 122 S+ I +FG +D LVNNAG+ ++ P L+ A++E + N G Sbjct: 83 ESQWITCAKSIEDQFGGLDILVNNAGITG---FLESAGPHDPEHLDLASWETVHATNLNG 139 Query: 123 VFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKELGKHG 182 V L + + M RS IVN+SS SGL G G + YA++KA + + T+S + + G Sbjct: 140 VALGCKYGIKLMKSSRSASIVNISSRSGLVGIPGAAAYASSKAGVRNHTKSVALHCAEKG 199 Query: 183 --IRVVGVAPGILEKTGLRTPEYEEAL--AWTRNITVEQLREGYSKNSIPLGRSGRLTEV 238 IR + PG + +P +E L R + ++ G +P+GR G+ +V Sbjct: 200 YPIRCNSIHPG-----AIMSPMWEAMLGEGEAREAAIAEVEAG-----VPIGRMGKPEDV 249 Query: 239 ADFVCYLLSERASYMTGVTTNIAGGKTRG 267 A YL S+ ++Y+TG+ NI GG G Sbjct: 250 AYAALYLASDESNYVTGIELNIDGGILAG 278 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 286 Length adjustment: 25 Effective length of query: 242 Effective length of database: 261 Effective search space: 63162 Effective search space used: 63162 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory