Align sorbitol-6-phosphate dehydrogenase subunit (EC 1.1.1.140) (characterized)
to candidate GFF901 HP15_880 oxidoreductase, short chain dehydrogenase/reductase family
Query= metacyc::MONOMER-13092 (266 letters) >FitnessBrowser__Marino:GFF901 Length = 243 Score = 93.6 bits (231), Expect = 4e-24 Identities = 91/260 (35%), Positives = 125/260 (48%), Gaps = 31/260 (11%) Query: 14 VTGASSGIGKAIVDELLSLKVKVANFDLTDN--GEK-----HENLLFQKVDVTSREQVEA 66 +TG + GIG+ IV L + KVA D TD+ GE+ L F DV S VE Sbjct: 1 MTGGAKGIGRGIVLHLAAAGWKVAFCD-TDSAVGERLAAGADYALHFLPGDVASETDVER 59 Query: 67 SVAAVVEHFGTVDAVVNNAGINIPRLLVDPKDPHGQYELDDATFEKITMINQKGLYLVSQ 126 VA + G +DAV+NNAGI P P + LD +++ +N G +LV++ Sbjct: 60 IVAEALRWGGRLDAVINNAGIANPET-----GPIEELSLDQ--WQRRLDVNLTGPFLVTK 112 Query: 127 -AVGRLLVAKKKGVIINMASEAGLEGSEGQSAYAGTKAAVYSYTRSWAKELGKYGVRVVG 185 AV L K KG I+NMAS L+ AYA TK + + T + A LG VRV Sbjct: 113 HAVPHL--RKTKGAIVNMASTRALQSEPDTEAYAATKGGIVALTHALAVSLGP-DVRVNC 169 Query: 186 IAPGIMEATGLRTLAYEEALGYTRGKTVEEIRAGYASTTTTPLGRSGKLSEVADLVAYYI 245 I+PG ++ T A++ + VE + P GR G+ ++A LVAY I Sbjct: 170 ISPGWID-----TRAWQGG-----AEPVEPLSEN--DHLQHPAGRVGQPGDIASLVAYLI 217 Query: 246 SDRSSYITGITTNVAGGKTR 265 S +S+ITG GG R Sbjct: 218 SQEASFITGQNFVADGGMVR 237 Lambda K H 0.313 0.131 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 243 Length adjustment: 24 Effective length of query: 242 Effective length of database: 219 Effective search space: 52998 Effective search space used: 52998 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory