GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fruII-ABC in Marinobacter adhaerens HP15

Align The fructose porter, FruA (fructose-1-P forming IIABC) (Delobbe et al. 1975) FruA is 39% identical to 4.A.2.1.1). fructose can be metabolized to Fru-1-P via this system as well as Fru-6-P by another PTS system (characterized)
to candidate GFF3783 HP15_3725 PTS system, fructose-specific IIBC component

Query= TCDB::P71012
         (635 letters)



>lcl|FitnessBrowser__Marino:GFF3783 HP15_3725 PTS system,
           fructose-specific IIBC component
          Length = 587

 Score =  414 bits (1063), Expect = e-120
 Identities = 222/468 (47%), Positives = 308/468 (65%), Gaps = 21/468 (4%)

Query: 167 AGKGKILAVTACPTGIAHTFMAADALKEKAKELGVEIKVETNGSSGIKHKLTAQEIEDAP 226
           AGK +I+AVTACPTG+AHTFMAA+AL   A+  G +I+VET GS G +  LT +EI  A 
Sbjct: 125 AGK-RIVAVTACPTGVAHTFMAAEALTAAAQSAGHKIRVETQGSVGAQDPLTEEEIAAAD 183

Query: 227 AIIVAADKQVEMERFKGKRVLQVPVTAGIRRPQELIEKAMNQDAPIYQGSGGGSAASNDD 286
            +I+A D +V+  RF GKRV +    A +++P + I  A+ Q   +  G           
Sbjct: 184 VVILACDIEVDPGRFSGKRVWRTSTGAALKKPADTIRDALEQAVVLNAGQ---------- 233

Query: 287 EEAKGKSGSGIGNTFYKHLMSGVSNMLPFVVGGGILVAISFFWGIHSADPNDPSYNTFAA 346
           ++  G SGSG     YKHL++GVS MLP VV GG+L+A+SF +GI +         T AA
Sbjct: 234 KKTSGASGSGEKKGPYKHLLTGVSFMLPMVVAGGLLIALSFVFGIEAFQEE----GTLAA 289

Query: 347 ALNFIGGDNALKLIVAVLAGFIAMSIADRPGFAPGMVGGFMATQANAGFLGGLIAGFLAG 406
           AL  IGG  A KL++ +LAG+IA SIADRPG APGM+GGF+A +  AGFLGG++AGFLAG
Sbjct: 290 ALMQIGGGTAFKLMIPLLAGYIAWSIADRPGLAPGMIGGFLAGELGAGFLGGIVAGFLAG 349

Query: 407 YVVILLKKVFTFIPQSLDGLKPVLIYPLFGIFITGVLMQFVVNTPVAAFMNFLTNWLESL 466
           YV   + +    +P+S++ LKP+LI PL    +TG+ M +V+  P+AA M  LT +LE +
Sbjct: 350 YVARFISQKLP-MPESIESLKPILIIPLLASLVTGLGMIYVIGEPMAAIMGALTGFLEGM 408

Query: 467 GTGNLVLMGIILGGMMAIDMGGPLNKAAFTFGIAMID--AGNYAPHAAIMAGGMVPPLGI 524
           GT N +L+G ILG MM  D+GGP+NKAA+TFG+ ++   +G  AP AAIMA GMVP +G+
Sbjct: 409 GTTNAILLGGILGAMMCFDLGGPVNKAAYTFGVGLLSEGSGGSAPMAAIMAAGMVPAIGM 468

Query: 525 ALATTIFRNKFTQRDREAGITCYFMGAAFVTEGAIPFAAADPLRVIPAAVVGAAVAGGLT 584
            +A+ I R KF + +R+AG   + +G  F++EGAIPF A DPLRVIP  ++G A+ G L+
Sbjct: 469 GVASFIARRKFAEAERQAGRASFVLGLCFISEGAIPFMAKDPLRVIPVCMIGGAITGALS 528

Query: 585 EFFRVTLPAPHGGVFVAFITN---HPMLYLLSIVIGAVVMAIILGIVK 629
             F V L APHGG+FV  I N     + YL++I +G++V+     ++K
Sbjct: 529 MLFTVKLMAPHGGLFVLAIPNAVSAVLPYLIAIAVGSLVIGFGYALLK 576



 Score = 67.4 bits (163), Expect = 2e-15
 Identities = 35/101 (34%), Positives = 56/101 (55%), Gaps = 1/101 (0%)

Query: 172 ILAVTACPTGIAHTFMAADALKEKAKELGVEIKVETNGSSG-IKHKLTAQEIEDAPAIIV 230
           ++ VTACP G+A  F+AA AL+  A   G  +  +T G  G   +K +   I+ A  +I 
Sbjct: 3   LIIVTACPQGVATRFLAARALERAANRRGWSVTTDTRGPDGKTDNKPSEAAIQQADLVIA 62

Query: 231 AADKQVEMERFKGKRVLQVPVTAGIRRPQELIEKAMNQDAP 271
           A    V ++ + GKR+LQ+PVTA +  P  ++ +A  +  P
Sbjct: 63  AVGIPVNLDVYAGKRLLQIPVTAALPDPDAILTRAQAEATP 103


Lambda     K      H
   0.320    0.137    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 885
Number of extensions: 34
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 635
Length of database: 587
Length adjustment: 37
Effective length of query: 598
Effective length of database: 550
Effective search space:   328900
Effective search space used:   328900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory