Align ABC transporter (characterized, see rationale)
to candidate GFF4122 HP15_4062 spermidine/putrescine ABC transporter, ATP-binding protein
Query= uniprot:A0A166QFW2 (381 letters) >FitnessBrowser__Marino:GFF4122 Length = 373 Score = 246 bits (629), Expect = 6e-70 Identities = 139/322 (43%), Positives = 203/322 (63%), Gaps = 10/322 (3%) Query: 4 LKLDNVNKQLGGMRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLLID 63 L L N++KQ GG +L + LEI GEF+ +GPSGCGK+TLLRL+AG + G + + Sbjct: 6 LSLSNLSKQFGGKTVLDGLDLEIYDGEFITLLGPSGCGKTTLLRLMAGFEHPDEGTITLA 65 Query: 64 GRRVNDLEPRERGVGMVFQSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLKTAQILQL 123 G + P R + VFQ YAL+PHMSV+DN+++GLK+ K K +R+RV + ++QL Sbjct: 66 GENLTHTAPENRPLNTVFQHYALFPHMSVFDNVAYGLKMEKRPKDEIRQRVDEALAMVQL 125 Query: 124 DKLLQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLHDRL 183 +RKP +LSGGQ+QRVA+ RA+ + P +LL DEPLS LD LR M+ E+ RL L Sbjct: 126 QDFARRKPHQLSGGQQQRVAIARAVVKRPRLLLLDEPLSALDYKLRRTMQVELKRLQREL 185 Query: 184 GSTMIYVTHDQVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGSPRMNFLS 243 G T ++VTHDQ EA++++D++VVL G V+Q+G+PRE+YERPA+ F A F+G NF Sbjct: 186 GITFVFVTHDQEEALSMSDRVVVLKDGLVQQLGTPREVYERPANLFTARFVG--ETNFFP 243 Query: 244 ARLQTPGETSL-VDTLVWGI-TSLPFDSSNLAAGTPLSLGIRPEHVSLKAADGTAGVVVT 301 +++ + S+ VD V+G+ +L + A L + +RPE + + D GV Sbjct: 244 GTVESVQDGSIKVD--VFGLKRTLRRPDFPVQAEQSLHVLLRPEDIRVLEPDDENGVAGK 301 Query: 302 AVE--YLGS--ETYVHLETGQD 319 VE Y GS ++ +HL G + Sbjct: 302 IVERNYKGSTLDSVIHLADGTE 323 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 373 Length adjustment: 30 Effective length of query: 351 Effective length of database: 343 Effective search space: 120393 Effective search space used: 120393 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory