Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate GFF2987 HP15_2931 glycerate dehydrogenase
Query= BRENDA::F8A9V0 (325 letters) >FitnessBrowser__Marino:GFF2987 Length = 320 Score = 146 bits (369), Expect = 6e-40 Identities = 95/250 (38%), Positives = 144/250 (57%), Gaps = 21/250 (8%) Query: 71 LALRSAGYDHIDIETAKRLGIKVVNVPAYSPHAIADHTLAIMLALIRRLHRAHDKVRLGD 130 +A+ + G ++ID AK GIKV+NV Y +A HT+A+MLAL RL V+ G Sbjct: 78 IAVVATGLNNIDQAAAKDHGIKVMNVTNYGRSTVAQHTMALMLALATRLLDYTRDVQAGH 137 Query: 131 F---DLDGLMG---FDLNGKVAGVIGLGKIGRLVATRLKAFGCKVL-GYDPYIQPEIVEN 183 + D+ LM +L G+ G++G G +G+ VA R AFG KVL G P +P +V+ Sbjct: 138 WGKSDMFCLMDHPIMELEGRTLGIVGYGDLGQGVAERAAAFGMKVLLGARPGQEPGVVDG 197 Query: 184 ---VDLDTLITQADIISIHCPLTRENFHMFNEETFKRMKPGAILVNTARGGLIDTKALLE 240 + LD L+ QAD++S+HC LT E + K MKP ++L+NT+RGGL++ +AL + Sbjct: 198 YSRIPLDELLPQADVVSLHCLLTDETRDLIGARELKMMKPDSLLINTSRGGLVNEQALAD 257 Query: 241 ALKSGKLGGAALDVYEYERGLFFKNHQKEGIKDPYLAQLLGLANVVLTGHQAFLTREAVK 300 AL++G++GGA DV E + G +P LA + N+++T H A+ +REA + Sbjct: 258 ALRAGEIGGAGFDVLTEE-------PPRNG--NPLLAD--DIPNLIVTPHSAWASREARQ 306 Query: 301 NIEETTVENI 310 I T N+ Sbjct: 307 RIVGITAVNL 316 Lambda K H 0.321 0.140 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 320 Length adjustment: 28 Effective length of query: 297 Effective length of database: 292 Effective search space: 86724 Effective search space used: 86724 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory