GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acnD in Marinobacter adhaerens HP15

Align 2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) (EC 4.2.1.117) (characterized)
to candidate GFF1973 HP15_1930 aconitate hydratase 1

Query= BRENDA::Q8EJW3
         (867 letters)



>lcl|FitnessBrowser__Marino:GFF1973 HP15_1930 aconitate hydratase 1
          Length = 865

 Score = 1402 bits (3628), Expect = 0.0
 Identities = 687/861 (79%), Positives = 765/861 (88%), Gaps = 1/861 (0%)

Query: 5   MNTQYRKPLPGTALDYFDTREAIEAIAPGAYAKLPYTSRVLAENLVRRCEPEMLTASLKQ 64
           MNT+YRK LPGT LDYFDTR+A+E I  GAY KLPYTS++LAE LVRRC+PE+LT SLKQ
Sbjct: 1   MNTEYRKSLPGTDLDYFDTRQAVEDIQAGAYDKLPYTSKILAEQLVRRCDPEVLTDSLKQ 60

Query: 65  IIESKQELDFPWFPARVVCHDILGQTALVDLAGLRDAIAAKGGDPAQVNPVVPTQLIVDH 124
           +IE K++LDFPW+PARVVCHDILGQTALVDLAGLRDAIA KGGDPA+VNPVVPTQLIVDH
Sbjct: 61  LIERKRDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEKGGDPAKVNPVVPTQLIVDH 120

Query: 125 SLAVEYGGFDKDAFAKNRAIEDRRNEDRFHFINWTQKAFKNIDVIPQGNGIMHQINLERM 184
           SLAVE+ GF+KDAF KNR IEDRRN+DRFHFINWT+ AFKN+DVIP GNGIMHQINLE+M
Sbjct: 121 SLAVEHAGFEKDAFEKNREIEDRRNDDRFHFINWTKTAFKNVDVIPPGNGIMHQINLEKM 180

Query: 185 SPVIHARNGVAFPDTLVGTDSHTPHVDALGVIAIGVGGLEAESVMLGRASYMRLPDIIGV 244
           SPV+  R+GVAFPDT VGTDSHTP VDALGVI++GVGGLEAESVMLGRAS MRLPDI+GV
Sbjct: 181 SPVVQNRDGVAFPDTCVGTDSHTPMVDALGVISVGVGGLEAESVMLGRASMMRLPDIVGV 240

Query: 245 ELTGKPQPGITATDIVLALTEFLRAQKVVSSYLEFFGEGAEALTLGDRATISNMTPEFGA 304
           ELTGK QPGIT+TD+VLA+TEFLR +KVV +YLEF+GEGA++L++GDRATISNMTPE+GA
Sbjct: 241 ELTGKLQPGITSTDMVLAITEFLRKEKVVGAYLEFYGEGADSLSVGDRATISNMTPEYGA 300

Query: 305 TAAMFYIDQQTLDYLTLTGREAEQVKLVETYAKTAGLWSDDLKQAVYPRTLHFDLSSVVR 364
           TAAMFYID QT+DYL LTGRE +QV LVE +AK  GLW+D +K A Y R L FDLS V R
Sbjct: 301 TAAMFYIDGQTIDYLKLTGREDDQVALVEKFAKETGLWADSMKNAEYERVLKFDLSKVTR 360

Query: 365 TIAGPSNPHARVPTSELAARGISGEVENEPGLMPDGAVIIAAITSCTNTSNPRNVIAAGL 424
           T+AGPSNPHA +PTSELAARGI+GE E E G MPDGA IIAAITSCTNTSNPRN++AAGL
Sbjct: 361 TLAGPSNPHAHLPTSELAARGIAGEWEQEEGKMPDGACIIAAITSCTNTSNPRNMVAAGL 420

Query: 425 LARNANAKGLTRKPWVKTSLAPGSKAVQLYLEEANLLPELESLGFGIVGFACTTCNGMSG 484
           +ARNAN  GLTRKPWVKTSLAPGSK V++YLEEA LLPELE LGFG+V FACTTCNGMSG
Sbjct: 421 IARNANKLGLTRKPWVKTSLAPGSKTVKMYLEEAKLLPELEQLGFGVVAFACTTCNGMSG 480

Query: 485 ALDPVIQQEVIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIE 544
           ALDP I QE++DRDL++TAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIE
Sbjct: 481 ALDPKIAQEIMDRDLFSTAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIE 540

Query: 545 KDVLGLDKDGKPVRLINIWPSDAEIDAVIAASVKPEQFRKVYEPMFDLSVDYGDKVSPLY 604
           KD LG D+DG PV L +IWP DAEIDA++ +SVKPEQFR  Y PMFD++ D     +PLY
Sbjct: 541 KDALGYDQDGNPVTLKDIWPDDAEIDAIVKSSVKPEQFRSTYIPMFDITRDAQANTNPLY 600

Query: 605 DWRPQSTYIRRPPYWEGALAGERTLKGMRPLAVLGDNITTDHLSPSNAIMMDSAAGEYLH 664
            WRPQSTYIRRPPYWEG + GE+TLKGMRPLAVL DNITTDHLSPSNAIMM+SAAGEYLH
Sbjct: 601 KWRPQSTYIRRPPYWEGGMVGEKTLKGMRPLAVLPDNITTDHLSPSNAIMMNSAAGEYLH 660

Query: 665 KMGLPEEDFNSYATHRGDHLTAQRATFANPKLKNEMA-IVDGKVKQGSLARIEPEGIVTR 723
           KMG+PEEDFNSYATHRGDHLTAQRATFANPKL NEM    +G VKQGSLARIEPEG V R
Sbjct: 661 KMGVPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVRDENGNVKQGSLARIEPEGKVVR 720

Query: 724 MWEAIETYMDRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGM 783
           MWEAIETYM+RKQPLIIIAGADYGQGSSRDWAAKGV LAGVEAIVAEGFERIHRTNL+GM
Sbjct: 721 MWEAIETYMERKQPLIIIAGADYGQGSSRDWAAKGVALAGVEAIVAEGFERIHRTNLIGM 780

Query: 784 GVLPLEFKAGENRATYGIDGTEVFDVIGSIAPRADLTVIITRKNGERVEVPVTCRLDTAE 843
           GV+PL+F+ G  R T GIDGTE +DV G+ APRA+LT++I RKNG    +PV CRLDTAE
Sbjct: 781 GVMPLQFEEGTTRKTLGIDGTETYDVEGTPAPRAELTLVIHRKNGSTERIPVVCRLDTAE 840

Query: 844 EVSIYEAGGVLQRFAQDFLES 864
           EVSIY AGGVLQRFA+DFL+S
Sbjct: 841 EVSIYSAGGVLQRFAEDFLQS 861


Lambda     K      H
   0.318    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 2211
Number of extensions: 93
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 867
Length of database: 865
Length adjustment: 42
Effective length of query: 825
Effective length of database: 823
Effective search space:   678975
Effective search space used:   678975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory