GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aldA in Marinobacter adhaerens HP15

Align NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate GFF964 HP15_943 aldehyde dehydrogenase family protein

Query= metacyc::MONOMER-16244
         (495 letters)



>lcl|FitnessBrowser__Marino:GFF964 HP15_943 aldehyde dehydrogenase
           family protein
          Length = 505

 Score =  367 bits (942), Expect = e-106
 Identities = 197/470 (41%), Positives = 277/470 (58%), Gaps = 5/470 (1%)

Query: 24  FINNEFVQSKSKKTFGTVSPSTEEEITQVYEAFSEDIDDAVEAATAAFHSS-WSTSDPQV 82
           ++N  +  + + + F +VSP    E+  +      D D AV AA AAF +  WS   P  
Sbjct: 30  YLNGTYQWAANGEAFTSVSPIDGRELASIASCDQSDADQAVMAARAAFEAGIWSQLAPAK 89

Query: 83  RMKVLYKLADLIDEHADTLAHIEALDNGKSLM-CSKGDVALTAAYFRSCAGWTDKIKGSV 141
           R  VL + A+LI+ H D LA +E LD GK +   S  DV  TA   R  A   DK+ G +
Sbjct: 90  RKAVLLRFAELIEAHGDELALLETLDMGKPINHASNVDVPATARAIRWTAEAIDKVYGEL 149

Query: 142 IETGDTHFNYTRREPIGVCGQIIPWNFPLLMASWKLGPVLCTGCTTVLKTAESTPLSALY 201
             T         REP+GV   I+PWNFP++MA+WK+ P L TG + +LK +E +PLSA+ 
Sbjct: 150 APTPHNQIGMISREPMGVVAAIVPWNFPMIMAAWKIAPALATGNSVILKPSEKSPLSAIR 209

Query: 202 LASLIKEAGAPPGVVNVVSGFGPTAGAPISSHPKIKKVAFTGSTATGRHIMKAAAESNLK 261
           LA+L  EAG P GV NV+ G+G T G  ++ H  +  + FTGST   + +M  A +SN+K
Sbjct: 210 LAALAGEAGVPAGVFNVLPGYGHTVGKALALHMDVDCLVFTGSTNVAKQLMIYAGQSNMK 269

Query: 262 KVTLELGGKSPNIVFDDA-DVKSTIQHLVTGIFYNTGEVCCAGSRIYVQEGIYDKIVSEF 320
           +V LE GGKSPNIVF DA D+K       + I +N GEVC AGSR+ V+  I  + V   
Sbjct: 270 RVWLEAGGKSPNIVFADAPDLKKAAAEAASAIAFNQGEVCTAGSRLLVENSIRAEFVRLI 329

Query: 321 KNAAESLKIGDPFKEDTFMGAQTSQLQLDKILKYIDIGKKEGATVITGGERF--GNKGYF 378
             A ++ + G P    T  GA   Q QLD+I+ YI IG+ EGA ++ GG+R      G F
Sbjct: 330 CEALKTWRPGHPLDPATTCGAIVDQAQLDRIIDYIGIGQSEGARLVEGGQRILENTGGLF 389

Query: 379 IKPTIFGDVKEDHQIVRDEIFGPVVTITKFKTVEEVIALANDSEYGLAAGVHTTNLSTAI 438
           ++PT+F  V    +I  +EIFGPV+++  F T +E +A+ANDS YGLAA V T+N++TA 
Sbjct: 390 VQPTVFDGVNNQMRIASEEIFGPVLSVIGFDTADEAVAIANDSIYGLAAAVWTSNINTAH 449

Query: 439 SVSNKINSGTIWVNTYNDFHPMVPFGGYSQSGIGREMGEEALDNYTQVKA 488
            V+  + +G++W+N Y+      PFGG+ QSG GR+    A D YT++KA
Sbjct: 450 KVAKALRAGSVWINHYDGGDMTAPFGGFKQSGNGRDKSVHAFDKYTELKA 499


Lambda     K      H
   0.316    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 584
Number of extensions: 24
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 495
Length of database: 505
Length adjustment: 34
Effective length of query: 461
Effective length of database: 471
Effective search space:   217131
Effective search space used:   217131
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory