GapMind for catabolism of small carbon sources

 

Aligments for a candidate for braD in Marinobacter adhaerens HP15

Align NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate GFF2059 HP15_2015 inner-membrane translocator

Query= TCDB::Q8YXD0
         (288 letters)



>lcl|FitnessBrowser__Marino:GFF2059 HP15_2015 inner-membrane
           translocator
          Length = 298

 Score =  125 bits (315), Expect = 9e-34
 Identities = 90/292 (30%), Positives = 149/292 (51%), Gaps = 15/292 (5%)

Query: 4   QTIQLIVNGIAVGSIIALAAVGLTLTYGILRLSNFAHGDFLTLGAY-----LTFFVNTFG 58
           Q + ++V+G    S + + + GLTL YG++R+ N +HG F  LGAY     + ++ +T  
Sbjct: 3   QLLAILVDGSVYASWLFIISAGLTLIYGVMRILNMSHGSFYALGAYSGAAMVGWYFSTGS 62

Query: 59  VNIWLSMIV----AVVGTVGVMLLSEKLLWSRMRSIRANSTTLIIISIGLALFLRNGIIL 114
           V  W S +     A+V  + V LL E+ L   M     +   +I+++ G+ L + + I L
Sbjct: 63  VP-WFSFVALIAAALVAGISVGLLVERGLLRFMYG--RDEVVMILVTYGVLLIMEDAIKL 119

Query: 115 IWGGRNQNYNLPIT--PALDIFGVKVPQNQLLVLALAVLSIGALHYLLQNTKIGKAMRAV 172
           IWG        P T        G+       +++ +++L   AL Y L  T+ GK +R V
Sbjct: 120 IWGVEPYFAYQPYTLLGRTKFAGLSFANYDFMLIGVSILIGLALWYGLNRTRNGKLLRVV 179

Query: 173 ADDLDLAKVSGIDVEQVIFWTWLIAGTVTSLGGSMYGLITAVRPNMGWFLILPLFASVIL 232
             D ++A   GI+V ++   T+LI   + SL G++     +V P MG  +I+  FA V++
Sbjct: 180 IHDREIASALGINVARIFTITFLIGAGIGSLAGALTAPGLSVVPGMGIEVIVLAFAVVVI 239

Query: 233 GGIGNPYGAIAAAFIIGIVQEVSTPFLGSQYKQGVALLIMILVLLIRPKGLF 284
           GG+G+  GA+  A I+G +   +   L    +  V   +M LVL  RP+GLF
Sbjct: 240 GGLGSITGALVGALIVG-MSRAAAVHLYPDVELFVIYAVMGLVLAFRPQGLF 290


Lambda     K      H
   0.328    0.144    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 256
Number of extensions: 17
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 288
Length of database: 298
Length adjustment: 26
Effective length of query: 262
Effective length of database: 272
Effective search space:    71264
Effective search space used:    71264
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory