Align lactoylglutathione lyase (EC 4.4.1.5) (characterized)
to candidate GFF2946 HP15_2890 lactoylglutathione lyase
Query= BRENDA::Q9CPU0 (184 letters) >FitnessBrowser__Marino:GFF2946 Length = 182 Score = 234 bits (597), Expect = 7e-67 Identities = 107/174 (61%), Positives = 137/174 (78%), Gaps = 11/174 (6%) Query: 10 GLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFS 69 GL +ET P T+ ++ QTM+RIK+P++S+DFYTRV+G+ L++KLDFP MKF+ Sbjct: 10 GLYEETV--------PETEGYVFNQTMMRIKEPERSMDFYTRVMGMRLVRKLDFPEMKFT 61 Query: 70 LYFLAYEDKND---IPKDKSEKTAWTFSRKATLELTHNWGTEDDETQSYHNGNSDPRGFG 126 LYFL Y D +P+D + +T +TF R+A LELTHNWGTEDD YHNGN +P+GFG Sbjct: 62 LYFLGYLDDRQAGLVPQDDAHRTTYTFGREAMLELTHNWGTEDDNDFGYHNGNDEPQGFG 121 Query: 127 HIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKI 180 HIG+AVPDVY+AC RF++LGV+FVKKPDDGKMKGLAFI+DPDGYWIEIL P+ + Sbjct: 122 HIGVAVPDVYAACDRFQKLGVEFVKKPDDGKMKGLAFIKDPDGYWIEILQPDML 175 Lambda K H 0.317 0.136 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 184 Length of database: 182 Length adjustment: 19 Effective length of query: 165 Effective length of database: 163 Effective search space: 26895 Effective search space used: 26895 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 44 (21.6 bits)
Align candidate GFF2946 HP15_2890 (lactoylglutathione lyase)
to HMM TIGR00068 (gloA: lactoylglutathione lyase (EC 4.4.1.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00068.hmm # target sequence database: /tmp/gapView.21826.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00068 [M=150] Accession: TIGR00068 Description: glyox_I: lactoylglutathione lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.9e-63 196.2 0.1 1.1e-62 196.0 0.1 1.0 1 lcl|FitnessBrowser__Marino:GFF2946 HP15_2890 lactoylglutathione lya Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF2946 HP15_2890 lactoylglutathione lyase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 196.0 0.1 1.1e-62 1.1e-62 9 145 .. 15 176 .. 7 181 .. 0.96 Alignments for each domain: == domain 1 score: 196.0 bits; conditional E-value: 1.1e-62 TIGR00068 9 edeatkkylllhtmlrvgdldksldfytevlGmkllrkkdfpeekfslaflgyedessa................ 67 + ++t++y++ +tm+r++++++s+dfyt+v+Gm+l+rk dfpe+kf+l+flgy d+ +a lcl|FitnessBrowser__Marino:GFF2946 15 TVPETEGYVFNQTMMRIKEPERSMDFYTRVMGMRLVRKLDFPEMKFTLYFLGYLDDRQAglvpqddahrttytfg 89 567899****************************************************9**************** PP TIGR00068 68 ..avieLtynwgtek.....ydlGn....gfGhiaiavddvykacervkakGgkvvrepgpvkggtkviafvkDP 131 a++eLt+nwgte+ y++Gn gfGhi++av+dvy+ac+r++++G+++v++p ++g++k++af+kDP lcl|FitnessBrowser__Marino:GFF2946 90 reAMLELTHNWGTEDdndfgYHNGNdepqGFGHIGVAVPDVYAACDRFQKLGVEFVKKP--DDGKMKGLAFIKDP 162 **************99******************************************9..************** PP TIGR00068 132 DGykiellekkktk 145 DGy+ie+l+ + + lcl|FitnessBrowser__Marino:GFF2946 163 DGYWIEILQPDMLE 176 *********88765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (150 nodes) Target sequences: 1 (182 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.22 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory