Align Hydroxyacylglutathione hydrolase; EC 3.1.2.6; Glyoxalase II; Glx II (uncharacterized)
to candidate GFF3790 HP15_3732 metallo-beta-lactamase family protein
Query= curated2:Q2RP80 (256 letters) >FitnessBrowser__Marino:GFF3790 Length = 302 Score = 80.9 bits (198), Expect = 3e-20 Identities = 60/190 (31%), Positives = 84/190 (44%), Gaps = 35/190 (18%) Query: 18 YLVRCRATGACAVIDPSL-------------AEPVLAAAESLGWTITHILNTHHHYDHTG 64 Y+V T CA+IDP L A+ +LA G+ + IL+TH H DH Sbjct: 30 YVVSDPETKQCAIIDPVLDYDEKSGATATHHADELLAFIREQGFEVQWILDTHPHADHFS 89 Query: 65 GNEEIKAATGCE--IIGFAGDAHRL-PGI-------------DRTVVEGDRVAIGQAEAR 108 + +K TG I G+ L GI D GD +G + R Sbjct: 90 AAQYLKEQTGAPTAIGGYVTGVQELWKGIYNWPDFPADGSQWDHLFRAGDEFRVGNLQGR 149 Query: 109 VIETPGHTLGHIAYWFAESSALFCGDTLFSAGCGRLFE----GSAGQMWDSLRKLRALPA 164 V+ +PGHTL + Y + A F DT+F G G A Q+WDS++ + ALP Sbjct: 150 VMFSPGHTLASVTYVIGD--AAFVHDTIFQPDFGTARADFPGGDAHQLWDSIQAILALPD 207 Query: 165 QTLVFCGHEY 174 +T +F GH+Y Sbjct: 208 ETRLFTGHDY 217 Lambda K H 0.322 0.137 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 302 Length adjustment: 25 Effective length of query: 231 Effective length of database: 277 Effective search space: 63987 Effective search space used: 63987 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory