Align 2-methylisocitrate lyase; 2-MIC; MICL; (2R,3S)-2-methylisocitrate lyase; EC 4.1.3.30 (characterized)
to candidate GFF1975 HP15_1932 methylisocitrate lyase 2
Query= SwissProt::Q8EJW1 (292 letters) >FitnessBrowser__Marino:GFF1975 Length = 295 Score = 401 bits (1030), Expect = e-116 Identities = 202/289 (69%), Positives = 236/289 (81%) Query: 4 SAGLRFRQALANSKPLQIVGTTNAYFALMAEQTGFQALYLSGAGVANASYGLPDLGMTSM 63 S G RFR+AL +++PLQIVGT NAY A+MAE+ G QA+YLSG GVANASYGLPDLGMTSM Sbjct: 6 SPGARFRKALKDNQPLQIVGTINAYAAMMAEKVGHQAIYLSGGGVANASYGLPDLGMTSM 65 Query: 64 NDVLIDAGRITSATQLPLLVDIDTGWGGAFNIARTIKEFEKIGVAAVHMEDQVSQKRCGH 123 N+V+ D RIT+AT +PLLVDIDTGWGGAFNIARTI+E E+ G AAVH+EDQV+QKRCGH Sbjct: 66 NEVVEDVRRITAATDVPLLVDIDTGWGGAFNIARTIREMERAGAAAVHIEDQVAQKRCGH 125 Query: 124 RPNKAVVSTEEMVDRIKAAVDARTDPNFVIMARTDAVAVEGLEAGIERAKAYIAAGADMI 183 RPNK +VS EEMVDRIKAAVDAR D +F IMARTDA EGLEA IERAKA I AGAD I Sbjct: 126 RPNKEIVSQEEMVDRIKAAVDAREDKDFFIMARTDAFQKEGLEAAIERAKACIEAGADGI 185 Query: 184 FAEALTELDQYRHFKAQVKAPILANMTEFGQTQLFNKEELAQAGADMVLYPLGTFRAANQ 243 FAEA+TEL+ Y+ F + PILAN+TEFG T L+N++ELA+AGADMVLYPL FRA N+ Sbjct: 186 FAEAVTELEHYKAFSEALDVPILANITEFGATPLYNRKELAEAGADMVLYPLSAFRAMNK 245 Query: 244 AALKVMQALMNDGHQRNVLDTMQTRADLYKYLGYHAFEDKLDQLFSQDK 292 AAL V Q ++ G Q++V+D MQTR +LY +L YH FE KLDQLF Q K Sbjct: 246 AALTVYQNILEKGDQKDVVDMMQTRMELYDFLNYHDFEQKLDQLFQQSK 294 Lambda K H 0.319 0.132 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 295 Length adjustment: 26 Effective length of query: 266 Effective length of database: 269 Effective search space: 71554 Effective search space used: 71554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate GFF1975 HP15_1932 (methylisocitrate lyase 2)
to HMM TIGR02317 (prpB: methylisocitrate lyase (EC 4.1.3.30))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02317.hmm # target sequence database: /tmp/gapView.8392.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02317 [M=285] Accession: TIGR02317 Description: prpB: methylisocitrate lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-133 429.1 4.3 4e-133 428.9 4.3 1.0 1 lcl|FitnessBrowser__Marino:GFF1975 HP15_1932 methylisocitrate lyase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF1975 HP15_1932 methylisocitrate lyase 2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 428.9 4.3 4e-133 4e-133 2 284 .. 8 291 .. 7 292 .. 0.99 Alignments for each domain: == domain 1 score: 428.9 bits; conditional E-value: 4e-133 TIGR02317 2 gkalrellkkedilqipGainalvallaekaGfeavYlsGaalaa.slglPDlglttleevaeearritrvtklp 75 g+++r++lk +++lqi+G+ina++a++aek+G++a+YlsG+++a+ s glPDlg+t+++ev+e++rrit++t++p lcl|FitnessBrowser__Marino:GFF1975 8 GARFRKALKDNQPLQIVGTINAYAAMMAEKVGHQAIYLSGGGVANaSYGLPDLGMTSMNEVVEDVRRITAATDVP 82 689*****************************************989**************************** PP TIGR02317 76 llvDaDtGfGealnvartvkeleeagvaavhieDqvapkkCGhldgkelvskeemvkkikaavkakkdedfvlia 150 llvD+DtG+G+a+n+art++e+e+ag+aavhieDqva+k+CGh+++ke+vs+eemv++ikaav+a++d+df+++a lcl|FitnessBrowser__Marino:GFF1975 83 LLVDIDTGWGGAFNIARTIREMERAGAAAVHIEDQVAQKRCGHRPNKEIVSQEEMVDRIKAAVDAREDKDFFIMA 157 *************************************************************************** PP TIGR02317 151 RtDaraveGldaaieRakaYveaGadaiftealeseeefrefakavkvpllanmtefGktplltadeleelgyki 225 RtDa eGl+aaieRaka +eaGad if+ea++++e+++ f++a++vp+lan+tefG tpl++ +el+e+g ++ lcl|FitnessBrowser__Marino:GFF1975 158 RTDAFQKEGLEAAIERAKACIEAGADGIFAEAVTELEHYKAFSEALDVPILANITEFGATPLYNRKELAEAGADM 232 *************************************************************************** PP TIGR02317 226 viyPvtalRaalkaaekvyeelkkkGtqkelldklqtRkelYellgyedyekkdkelfk 284 v+yP++a+Ra++kaa +vy+++ +kG qk+++d +qtR elY+ l+y+d+e+k+++lf+ lcl|FitnessBrowser__Marino:GFF1975 233 VLYPLSAFRAMNKAALTVYQNILEKGDQKDVVDMMQTRMELYDFLNYHDFEQKLDQLFQ 291 ********************************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (295 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.14 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory