GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Marinobacter adhaerens HP15

Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate GFF3096 HP15_3039 N-succinylglutamate 5-semialdehyde dehydrogenase

Query= BRENDA::P76217
         (492 letters)



>lcl|FitnessBrowser__Marino:GFF3096 HP15_3039 N-succinylglutamate
           5-semialdehyde dehydrogenase
          Length = 491

 Score =  594 bits (1531), Expect = e-174
 Identities = 287/484 (59%), Positives = 369/484 (76%), Gaps = 1/484 (0%)

Query: 3   LWINGDWITGQGASRVKRNPVSGEVLWQGNDADAAQVEQACRAARAAFPRWARLSFAERH 62
           L+I+G W+ G G       PV+GE LW G  A+   V+ A R AR AF +W R SFAER 
Sbjct: 8   LFIDGLWLPGHGPVFESVQPVTGETLWDGESANLEDVDAAVREARNAFVKWQRKSFAERQ 67

Query: 63  AVVERFAALLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSE 122
           AVVE F  LLE++K EL   I  ETGKP WE+ TEV AMI KI IS+KAY+ RTG   S+
Sbjct: 68  AVVEAFGELLEAHKEELAHQIGLETGKPLWESRTEVAAMIGKIGISVKAYNDRTGTSESD 127

Query: 123 MPDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTIIFKPSELTPWSGEAVMR 182
           +  G A LRHRPHGV+AVFGPYNFPGHLPNGHIVPALLAGNT++FKPSELTP   E  ++
Sbjct: 128 VAGGHAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALLAGNTVVFKPSELTPGVAELTVK 187

Query: 183 LWQQAGLPPGVLNLVQGGRETGQALSALEDLDGLLFTGSANTGYQLHRQLSGQPEKILAL 242
           LW +AG+P GV+NLVQG   TG++L+    +DGL FTGS+  G+ LH+Q  GQPEKI+AL
Sbjct: 188 LWGKAGIPDGVINLVQGASATGKSLAGHPLIDGLFFTGSSTVGHLLHKQFGGQPEKIVAL 247

Query: 243 EMGGNNPLIIDEVADIDAAVHLTIQSAFVTAGQRCTCARRLLLKSGAQGDAFLARLVAVS 302
           EMGGNNPLI+ +VAD+D AVH  +QSAF++AGQRCTCARRLL+  G +GDAF+ RLV VS
Sbjct: 248 EMGGNNPLIVQDVADVDGAVHHALQSAFLSAGQRCTCARRLLVPKGKKGDAFIDRLVEVS 307

Query: 303 QRLTPGNWDDEPQPFIGGLISEQAAQQVVTAWQQLEAMGGRPLLAPRLLQAGTSLLTPGI 362
            R+  G +D +PQPF+G +IS +AA++++ A   L   GG+ LL  + L++GT LL+PGI
Sbjct: 308 ARIKVGEFDADPQPFMGSVISSEAAEKLLAAQASLLEKGGKSLLEMKSLKSGTGLLSPGI 367

Query: 363 IEMTGVAGVPDEEVFGPLLRVWRYDTFDEAIRMANNTRFGLSCGLVSPEREKFDQLLLEA 422
           ++ TG+  V DEE FGPLL+V+RY +FD+A+ +AN+T +GLS G+++ +R+ +++L+ E 
Sbjct: 368 VDATGL-DVTDEEFFGPLLKVYRYKSFDDALALANDTHYGLSAGILTDDRKLYERLVEEV 426

Query: 423 RAGIVNWNKPLTGAASTAPFGGIGASGNHRPSAWYAADYCAWPMASLESDSLTLPATLNP 482
           RAGIVNWN+PLTGA+S APFGG+GASGNHRPSA+YAADYCAWPMASLE+    +P +L P
Sbjct: 427 RAGIVNWNRPLTGASSAAPFGGVGASGNHRPSAYYAADYCAWPMASLEAGKSEMPESLAP 486

Query: 483 GLDF 486
           GL+F
Sbjct: 487 GLNF 490


Lambda     K      H
   0.318    0.134    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 833
Number of extensions: 32
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 492
Length of database: 491
Length adjustment: 34
Effective length of query: 458
Effective length of database: 457
Effective search space:   209306
Effective search space used:   209306
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory