GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Marinobacter adhaerens HP15

Align 4-trimethylaminobutyraldehyde dehydrogenase; TMABA-DH; TMABADH; Aldehyde dehydrogenase family 9 member A1; Betaine aldehyde dehydrogenase; BADH; EC 1.2.1.47; EC 1.2.1.3 (characterized)
to candidate GFF3684 HP15_3626 betaine aldehyde dehydrogenase

Query= SwissProt::P56533
         (503 letters)



>lcl|FitnessBrowser__Marino:GFF3684 HP15_3626 betaine aldehyde
           dehydrogenase
          Length = 489

 Score =  513 bits (1321), Expect = e-150
 Identities = 261/484 (53%), Positives = 335/484 (69%), Gaps = 6/484 (1%)

Query: 22  NYWGGRRIKSKDGATTEPVFEPATGRVLCQMVPCGAEEVDQAVQSAQAAYLKWSKMAGIE 81
           N+  GR + +  G T  PV  PATG+V+ ++          A++SA+A + +WS M  IE
Sbjct: 10  NFVHGRFLANSTGETF-PVVNPATGQVIYEVEVADESVQQAAIESARAGFAEWSAMTAIE 68

Query: 82  RSRVMLEAARIIRERRDNIAKLEVINNGKTITEAE-YDIDAAWQCIEYYAGLAPTLSGQH 140
           RSR++L A  I+RER D +A  EV + GK   EAE  D+      +E++AGLAP++ G  
Sbjct: 69  RSRILLRAVAILRERNDELAAAEVRDTGKPWQEAEAVDVVTGADAVEFFAGLAPSIEGNQ 128

Query: 141 IQLPGGAFAYTRREPLGVCAGILAWNYPFMIAAWKCAPALACGNAVVFKPSPMTPVTGVI 200
             L GG F YTRREPLG+CAGI AWNYP  IA WK APALACGNA++FKPS  TP+  V 
Sbjct: 129 QDL-GGDFYYTRREPLGICAGIGAWNYPIQIACWKSAPALACGNAMIFKPSEETPMGAVK 187

Query: 201 LAEIFHEAGVPVGLVNVVQGGAETGSLLCHHPNVAKVSFTGSVPTGKKVMEMSAKTVKHV 260
           LAEIF EAGVP G+ NVVQG AE G  L HHP +AKVSFTG V TGKKVM  ++ T+K V
Sbjct: 188 LAEIFTEAGVPAGVFNVVQGAAEVGQWLTHHPEIAKVSFTGEVATGKKVMAAASSTLKDV 247

Query: 261 TLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQREIMPQFLEEVVKR 320
           T+ELGGKSPL+IF D +LENA+  A++ NF TQG++CTNGTRVFV  ++ P+F+E +++R
Sbjct: 248 TMELGGKSPLIIFDDADLENAISAAMVGNFYTQGEICTNGTRVFVHEDLYPRFIERLLER 307

Query: 321 TK-AIVVGDPLLTETRMGGLISKPQLDKVLGFVAQAKKEGARVLCGGEPLTPSDPKLKNG 379
           T+  I  GDP+  +T  G LIS    D VL ++A+   EGA +  GG    P D   K G
Sbjct: 308 TRNNIKPGDPMNPDTNFGALISAKHRDLVLDYIAKGLSEGATLSHGGRAFEPEDS--KGG 365

Query: 380 YFMSPCVLDNCRDDMTCVKEEIFGPVMSVLPFDTEEEVLQRANNTTFGLASGVFTRDISR 439
           YF+ P +  +C DDMT VKEEIFGPVMSVL F  E+EV+ RANNT  GLA+GVFT DI R
Sbjct: 366 YFVEPTIFTDCTDDMTIVKEEIFGPVMSVLTFRDEDEVIARANNTDTGLAAGVFTNDIRR 425

Query: 440 AHRVAANLEAGTCYINTYSISPVEVPFGGYKMSGFGRENGQATVDYYSQLKTVIVEMGDV 499
           AHRV   ++AG C+IN+Y  SP E+P GGYK+SG GRENG+ T+ +Y+Q+K+V V M D+
Sbjct: 426 AHRVIHQIQAGICWINSYGASPAEMPVGGYKLSGIGRENGRETIAHYTQIKSVYVGMEDL 485

Query: 500 DSLF 503
           D+ F
Sbjct: 486 DAPF 489


Lambda     K      H
   0.319    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 707
Number of extensions: 33
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 503
Length of database: 489
Length adjustment: 34
Effective length of query: 469
Effective length of database: 455
Effective search space:   213395
Effective search space used:   213395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory