Align phosphopentomutase (EC 5.4.2.7) (characterized)
to candidate GFF3130 HP15_3072 phosphoglucosamine mutase
Query= BRENDA::Q6I7B6 (450 letters) >FitnessBrowser__Marino:GFF3130 Length = 447 Score = 137 bits (346), Expect = 5e-37 Identities = 133/448 (29%), Positives = 203/448 (45%), Gaps = 55/448 (12%) Query: 2 RLFGTAGIRGTLWE-KVTPELAMKVGMAVGTY-----KSGKALVGRDGRTSSVMLKNAMI 55 + FGT GIRG + E +TPE +K+G A G + L+G+D R S M ++A+ Sbjct: 5 KYFGTDGIRGHVGEFPITPEFMLKLGWAAGQAFKRDGQRNSVLIGKDTRLSGYMFESALE 64 Query: 56 SGLLSTGMEVLDADLIPTPALAWGTRKL-ADAGVMITASHNPPTDNGVKVFNGDGTE--- 111 +GL + G++V +PTPA+A+ TR A AG++I+ASHNP DNG+K F+ GT+ Sbjct: 65 AGLAAAGVDVKLLGPMPTPAIAYLTRTFRASAGIVISASHNPHHDNGIKFFSAAGTKLDD 124 Query: 112 -FYVEQERGLE---EIIFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFVGHETNLKVLY 167 E ER L+ E+ KA + P R VE + G + ++ Sbjct: 125 ALEAEIERWLDKPIEVCGPTELGKASRVDDAPGRYVEFCKSTVPNEFTLDG----MNIVL 180 Query: 168 DGANGAGSLVAPYLLREMGAKVLSVNAHVDGHFPGRKPEPRYENIAYLGKLVRELGVDLA 227 D A+GA VAP + RE+GAKV + DG ++ L V E DL Sbjct: 181 DCAHGATYHVAPKVFRELGAKVSVIGGDPDG--LNINLNVGSTHLQALKAAVIEKNADLG 238 Query: 228 IAQDGDADRIAVFDEKGNYVDEDTVIALFA-KLYVEEHGGGTVVVSIDTGSRIDAVVERA 286 IA DGD DR+ + D G+ VD D ++ + A + + E+ G VV ++ T ++ + Sbjct: 239 IAFDGDGDRVLMVDRDGSEVDGDELLYVIASQRFAEDRLKGGVVGTLMTNLGVELALNEI 298 Query: 287 GGRVVRIPLGQPHDGIKRYKAIFAAEPWKLVHPKFGPWI--------DPFVT-MGLLIKL 337 G R +G + A W L G + D V+ + +L+ + Sbjct: 299 GIEFERAKVGD-----RYVMERLLANNWVLGGEGSGHMVIRDCTSTGDGIVSALQVLLSV 353 Query: 338 IDENGPLSELVKEIPTYYLKKANVLCP---DEYKAEVVRRAAEEVERKLSSEIKEVLTIS 394 L++L K + K NV D + + + A + E +L S + Sbjct: 354 WKSGKTLADLRKGMSKLPQKMINVRVAQRFDPFSRDDIVAAVRKAETELGSSGR------ 407 Query: 395 GFRIALNDGSWILIRPSGTEPKIRVVAE 422 IL+R SGTEP IRV+AE Sbjct: 408 -----------ILLRASGTEPLIRVMAE 424 Lambda K H 0.318 0.138 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 469 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 450 Length of database: 447 Length adjustment: 33 Effective length of query: 417 Effective length of database: 414 Effective search space: 172638 Effective search space used: 172638 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory