GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoB in Marinobacter adhaerens HP15

Align phosphopentomutase (EC 5.4.2.7) (characterized)
to candidate GFF3130 HP15_3072 phosphoglucosamine mutase

Query= BRENDA::Q6I7B6
         (450 letters)



>lcl|FitnessBrowser__Marino:GFF3130 HP15_3072 phosphoglucosamine
           mutase
          Length = 447

 Score =  137 bits (346), Expect = 5e-37
 Identities = 133/448 (29%), Positives = 203/448 (45%), Gaps = 55/448 (12%)

Query: 2   RLFGTAGIRGTLWE-KVTPELAMKVGMAVGTY-----KSGKALVGRDGRTSSVMLKNAMI 55
           + FGT GIRG + E  +TPE  +K+G A G       +    L+G+D R S  M ++A+ 
Sbjct: 5   KYFGTDGIRGHVGEFPITPEFMLKLGWAAGQAFKRDGQRNSVLIGKDTRLSGYMFESALE 64

Query: 56  SGLLSTGMEVLDADLIPTPALAWGTRKL-ADAGVMITASHNPPTDNGVKVFNGDGTE--- 111
           +GL + G++V     +PTPA+A+ TR   A AG++I+ASHNP  DNG+K F+  GT+   
Sbjct: 65  AGLAAAGVDVKLLGPMPTPAIAYLTRTFRASAGIVISASHNPHHDNGIKFFSAAGTKLDD 124

Query: 112 -FYVEQERGLE---EIIFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFVGHETNLKVLY 167
               E ER L+   E+       KA   +  P R VE     +       G    + ++ 
Sbjct: 125 ALEAEIERWLDKPIEVCGPTELGKASRVDDAPGRYVEFCKSTVPNEFTLDG----MNIVL 180

Query: 168 DGANGAGSLVAPYLLREMGAKVLSVNAHVDGHFPGRKPEPRYENIAYLGKLVRELGVDLA 227
           D A+GA   VAP + RE+GAKV  +    DG            ++  L   V E   DL 
Sbjct: 181 DCAHGATYHVAPKVFRELGAKVSVIGGDPDG--LNINLNVGSTHLQALKAAVIEKNADLG 238

Query: 228 IAQDGDADRIAVFDEKGNYVDEDTVIALFA-KLYVEEHGGGTVVVSIDTGSRIDAVVERA 286
           IA DGD DR+ + D  G+ VD D ++ + A + + E+   G VV ++ T   ++  +   
Sbjct: 239 IAFDGDGDRVLMVDRDGSEVDGDELLYVIASQRFAEDRLKGGVVGTLMTNLGVELALNEI 298

Query: 287 GGRVVRIPLGQPHDGIKRYKAIFAAEPWKLVHPKFGPWI--------DPFVT-MGLLIKL 337
           G    R  +G      +       A  W L     G  +        D  V+ + +L+ +
Sbjct: 299 GIEFERAKVGD-----RYVMERLLANNWVLGGEGSGHMVIRDCTSTGDGIVSALQVLLSV 353

Query: 338 IDENGPLSELVKEIPTYYLKKANVLCP---DEYKAEVVRRAAEEVERKLSSEIKEVLTIS 394
                 L++L K +     K  NV      D +  + +  A  + E +L S  +      
Sbjct: 354 WKSGKTLADLRKGMSKLPQKMINVRVAQRFDPFSRDDIVAAVRKAETELGSSGR------ 407

Query: 395 GFRIALNDGSWILIRPSGTEPKIRVVAE 422
                      IL+R SGTEP IRV+AE
Sbjct: 408 -----------ILLRASGTEPLIRVMAE 424


Lambda     K      H
   0.318    0.138    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 469
Number of extensions: 28
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 450
Length of database: 447
Length adjustment: 33
Effective length of query: 417
Effective length of database: 414
Effective search space:   172638
Effective search space used:   172638
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory