Align Anthranilate 1,2-dioxygenase (deaminating, decarboxylating) (EC 1.14.12.1) (characterized)
to candidate GFF1128 HP15_1106 Rieske (2Fe-2S) domain protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2740 (461 letters) >FitnessBrowser__Marino:GFF1128 Length = 414 Score = 375 bits (964), Expect = e-108 Identities = 194/420 (46%), Positives = 267/420 (63%), Gaps = 15/420 (3%) Query: 44 MELIFEKNWIYACHESEIANPNDFLTMRAGRQPMIITRDGNNQLHALINACQHRGATLTR 103 M+ IFE NW+Y HES+I NDF T GR P+IITRD + L+A +N C HRGA L R Sbjct: 1 MKYIFEGNWVYLAHESQIQENNDFFTTYIGRHPIIITRDKSGNLNAFLNICTHRGAMLCR 60 Query: 104 VSKGNQSTFTCPFHAWCYKSDGRLVKVKAP--GEYPEGFD-KATRGLKK-ARIESYKGFV 159 KGN+S TCPFH W + + G+LVKVK YP+ F+ + LK A+ +SY+GF+ Sbjct: 61 SKKGNKSVMTCPFHGWSFNNSGKLVKVKDEKGSGYPDSFNCEGELNLKNIAKFDSYRGFL 120 Query: 160 FISLDVNGSDSLEDYLGDAKVFFDMMVAQSPTGELEILPGKSTYSYDGNWKLQHENGLDG 219 F SL+ + D L DYLGD DM+V QS E+E+L G STY++DGNWK+Q ENG+DG Sbjct: 121 FGSLNSDVQD-LNDYLGDTTKIIDMIVDQSED-EIEVLRGASTYTFDGNWKVQAENGVDG 178 Query: 220 YHVSTVHYNYVSTVQHRQQVNAANGGVS-DTLDYSKLGAGDAETDDGWFSFKNGHSLLFS 278 YHVS VH+NYV+TV R+Q + + S D ++K G ++FKNGH+LL+ Sbjct: 179 YHVSAVHWNYVATVARRKQGLSEDSAKSVDLSSWNKQKGGS-------YAFKNGHTLLWM 231 Query: 279 DMPNPTVRAGYATVMPRLIEEYGQQQAEWMMHRLRNLNIYPSLFFMDQISSQLRIVRPVA 338 + PNP R A L +YG+ +A+WM+ +RNL IYP++F MDQ S+Q+R RP++ Sbjct: 232 EAPNPQDRP-LAEKREELSRKYGKNRADWMISNIRNLGIYPNVFLMDQTSTQIRHFRPIS 290 Query: 339 WNKTEITSQCIGVKGESDADRENRIRQFEDFFNVSGMGTPDDLVEFREAQRGFQARLERW 398 NKTE+T C K ES R RIRQ+EDFFN +GM TPDDL +F +Q F A W Sbjct: 291 VNKTEVTIYCFAPKNESGEARNRRIRQYEDFFNATGMATPDDLEQFNSSQISFHASKAPW 350 Query: 399 NEVSRGSEKWVEGPTPNSEVLGINPVLTGTEFTHEGLYINQHGSWQRFLLQGLEQKALKL 458 N++SRG++ W++G +E + I P+L+G + EGL++ QH W LL+G+ + K+ Sbjct: 351 NDLSRGAKHWIDGQDKEAESIDIFPLLSGVKSEDEGLFVMQHECWANALLRGMSDEEDKV 410 Lambda K H 0.318 0.135 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 560 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 461 Length of database: 414 Length adjustment: 32 Effective length of query: 429 Effective length of database: 382 Effective search space: 163878 Effective search space used: 163878 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory