Align Anthranilate 1,2-dioxygenase (deaminating, decarboxylating) (EC 1.14.12.1) (characterized)
to candidate GFF39 HP15_39 ring hydroxylating dioxygenase, alpha subunit
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2740 (461 letters) >FitnessBrowser__Marino:GFF39 Length = 438 Score = 139 bits (350), Expect = 2e-37 Identities = 68/197 (34%), Positives = 109/197 (55%), Gaps = 5/197 (2%) Query: 33 MFTEPELFDLEMELIFEKNWIYACHESEIANPNDFLTMRAGRQPMIITRDGNNQLHALIN 92 + ++ E++ LEME +F K W+ HESEI NP DF+ G +I+TRD + ++H L+N Sbjct: 3 VLSDREIYQLEMEKVFGKTWLMLGHESEIPNPGDFMVRDMGEDSVIVTRDKSGEVHVLLN 62 Query: 93 ACQHRGATLTRVSKGNQSTFTCPFHAWCYKSDGRLVKVKAPGEYPEG--FDKATRGLKKA 150 C HRG + GN C +H W ++ +G + E G +K+ GLK+A Sbjct: 63 VCPHRGMRVALTDCGNSQIHKCIYHGWAFRPNGDFIGAPVEKEKMHGSMLEKSELGLKRA 122 Query: 151 RIESYKGFVFISLDVNGSDSLEDYLGDAKVFFDMMVAQSPTGELEILPGKSTYSYDGNWK 210 R Y G +F + ++ G S +++LGDAK ++DM+ +S G +E+L + + NWK Sbjct: 123 RCTLYGGLIFATWNIEG-PSFDEFLGDAKWYYDMLFLRSDKG-MEVLGPPQRFIVNANWK 180 Query: 211 LQHE-NGLDGYHVSTVH 226 E + DG+H T+H Sbjct: 181 TAGEQSAADGFHTLTLH 197 Lambda K H 0.318 0.135 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 557 Number of extensions: 31 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 461 Length of database: 438 Length adjustment: 33 Effective length of query: 428 Effective length of database: 405 Effective search space: 173340 Effective search space used: 173340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory