Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate GFF5 HP15_5 acetyl-CoA acetyltransferase
Query= metacyc::MONOMER-15952 (401 letters) >FitnessBrowser__Marino:GFF5 Length = 416 Score = 335 bits (859), Expect = 1e-96 Identities = 188/401 (46%), Positives = 263/401 (65%), Gaps = 10/401 (2%) Query: 1 MNEALIIDAVRTPIGRYAGALASVRADDLGAIPLKALIARHPQLDWSAVDDVIYGCANQA 60 M +I+ A RT IG + GAL+ A DLGA +++L++ L+ VD+V+ G A Sbjct: 24 MQGVVIVAATRTAIGSFQGALSDTSAVDLGATVIRSLLSS-TSLNPELVDNVVMGQVLSA 82 Query: 61 GEDNRNVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVESM 120 G +N AR +A+ AGLP + P TLN+LCGSGL++V AA+A++C EA +++AGG+ESM Sbjct: 83 G-CGQNPARQSAIKAGLPFTTPAMTLNKLCGSGLESVNLAAQAIQCKEADVVVAGGMESM 141 Query: 121 SRAPFVMGKSEQAFGRS-AEIFDTTIGWRFVNKLMQQGFGIDSMPETAENVAAQFNISRA 179 S++P+++GK+ ++I D+ + ++ G+ TAEN+A ++ I+R Sbjct: 142 SQSPYLLGKARSGLRMGHSQIEDSMLTDGLIDAFNHYHMGV-----TAENLAEKYQITRE 196 Query: 180 DQDAFALRSQHKAAAAIANGRLAKEIVAVEIAQRKGPAKIVEHDEHPRGDTTLEQLAKLG 239 QDAFA+ SQ K + A+A+GR EI VEI QRKG + DE PRGD + L+KL Sbjct: 197 QQDAFAVISQLKGSEAVASGRFKDEITPVEIPQRKGSPLKFDTDEQPRGDVSSAGLSKLR 256 Query: 240 TPFRQGGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMATAGVEPRIMGIGP 299 F +GGSVTAGNAS +NDGA A+LL S+E A GL AR+ A+A V+P IMGIGP Sbjct: 257 PAFAKGGSVTAGNASSLNDGAAAVLLMSAEKATELGLTVLARIKSYASAAVDPSIMGIGP 316 Query: 300 VPATRKVLELTGLALADMDVIELNEAFAAQGLAVLRELGLADDDERVNPNGGAIALGHPL 359 VPATRK L ++ D+D+IE NEAFAAQ L+V +ELG + E+VN NGGAIALGHP+ Sbjct: 317 VPATRKCLAKVNWSVGDLDLIEANEAFAAQCLSVGKELGW--ESEKVNVNGGAIALGHPI 374 Query: 360 GMSGARLVTTALHELEERQGRYALCTMCIGVGQGIALIIER 400 G SG R++ T L+E+ R + L T+CIG GQG+A+ +ER Sbjct: 375 GASGCRILVTLLYEMTRRDSKKGLATLCIGGGQGVAMALER 415 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 416 Length adjustment: 31 Effective length of query: 370 Effective length of database: 385 Effective search space: 142450 Effective search space used: 142450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory