GapMind for catabolism of small carbon sources

 

Aligments for a candidate for praD in Marinobacter adhaerens HP15

Align 4-oxalocrotonate decarboxylase subunit (EC 4.1.1.77) (characterized)
to candidate GFF1138 HP15_1116 hydratase/decarboxylase

Query= metacyc::MONOMER-12752
         (264 letters)



>lcl|FitnessBrowser__Marino:GFF1138 HP15_1116
           hydratase/decarboxylase
          Length = 264

 Score =  457 bits (1177), Expect = e-134
 Identities = 224/263 (85%), Positives = 248/263 (94%)

Query: 1   MNRTLNREQVLALAEHIENAELQAHDIHKVTNDYPEMTFADAYTIQWEIRRRKEERGNKI 60
           M++TL++EQVLALAEH+ENAELQAHDI KVTND+P+MTF DAY +QWEIRRRKE RGNKI
Sbjct: 1   MSKTLSQEQVLALAEHVENAELQAHDITKVTNDFPDMTFEDAYDVQWEIRRRKEARGNKI 60

Query: 61  VGLKMGLTSWAKMAQMGVETPIYGFLADYFSVPDGGVVDCSKLIHPKIEAEIAVVTKAPL 120
           VG+KMGLTSWAKMAQMGVETPIYGFLADYFSVPDGGVV+  +LIHPKIEAEIA VTKAPL
Sbjct: 61  VGMKMGLTSWAKMAQMGVETPIYGFLADYFSVPDGGVVNTKELIHPKIEAEIAFVTKAPL 120

Query: 121 VGPGCHIGDVIAAVDYVIPTVEVIDSRYENFKFDLISVVADNASSTRYITGGRMANLEDV 180
            GPGCHIG V+AA D+VIP VEVIDSRYENFKFDL+SVVADNASSTR+ITGG+MA++ DV
Sbjct: 121 KGPGCHIGQVLAATDFVIPAVEVIDSRYENFKFDLVSVVADNASSTRFITGGQMADVADV 180

Query: 181 DLRTLGVVMEKNGEVVELGAGAAVLGHPLSSVAMLANLLAERGEHIPAGTFIMTGGITAA 240
           DL+TLGVV+EKNGEVV++GAGAAVLGHP SSVAMLANLLAERGEHIPAGTFIMTGGITAA
Sbjct: 181 DLKTLGVVVEKNGEVVDVGAGAAVLGHPASSVAMLANLLAERGEHIPAGTFIMTGGITAA 240

Query: 241 VAVAPGDNITVRYQGLGSVSARF 263
           + V PGDNITVRYQGLG+VSARF
Sbjct: 241 ITVEPGDNITVRYQGLGTVSARF 263


Lambda     K      H
   0.319    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 320
Number of extensions: 2
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 264
Length of database: 264
Length adjustment: 25
Effective length of query: 239
Effective length of database: 239
Effective search space:    57121
Effective search space used:    57121
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)

Align candidate GFF1138 HP15_1116 (hydratase/decarboxylase)
to HMM TIGR03218 (dmpH: 4-oxalocrotonate decarboxylase (EC 4.1.1.77))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03218.hmm
# target sequence database:        /tmp/gapView.23165.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03218  [M=263]
Accession:   TIGR03218
Description: catechol_dmpH: 4-oxalocrotonate decarboxylase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   9.8e-155  499.5   1.5   1.1e-154  499.3   1.5    1.0  1  lcl|FitnessBrowser__Marino:GFF1138  HP15_1116 hydratase/decarboxylas


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Marino:GFF1138  HP15_1116 hydratase/decarboxylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  499.3   1.5  1.1e-154  1.1e-154       2     263 .]       2     263 ..       1     263 [. 0.99

  Alignments for each domain:
  == domain 1  score: 499.3 bits;  conditional E-value: 1.1e-154
                           TIGR03218   2 eltltreqiealaehvenaeleareitkitdeyPdldfadaydiqaeirrrklarGakvvGlkaGltskakmkqm 76 
                                          +tl++eq+ alaehvenael+a++itk+t+++Pd++f+dayd+q+eirrrk+arG+k+vG+k+Glts+akm+qm
  lcl|FitnessBrowser__Marino:GFF1138   2 SKTLSQEQVLALAEHVENAELQAHDITKVTNDFPDMTFEDAYDVQWEIRRRKEARGNKIVGMKMGLTSWAKMAQM 76 
                                         679************************************************************************ PP

                           TIGR03218  77 GvetpvfGfladyfsvpdggeiktselihPkveaeiafvlkaelkgpgchigdvlaatdfvlpavevidsrykdf 151
                                         Gvetp++Gfladyfsvpdgg ++t+elihPk+eaeiafv+ka+lkgpgchig+vlaatdfv+pavevidsry++f
  lcl|FitnessBrowser__Marino:GFF1138  77 GVETPIYGFLADYFSVPDGGVVNTKELIHPKIEAEIAFVTKAPLKGPGCHIGQVLAATDFVIPAVEVIDSRYENF 151
                                         *************************************************************************** PP

                           TIGR03218 152 kfdlksvvadnassarfvtGgraaavedldlrtlGvvleknGevvalgagaavlGhpaaavamlanllaergeei 226
                                         kfdl svvadnass+rf+tGg++a+v+d+dl+tlGvv+eknGevv++gagaavlGhpa++vamlanllaerge+i
  lcl|FitnessBrowser__Marino:GFF1138 152 KFDLVSVVADNASSTRFITGGQMADVADVDLKTLGVVVEKNGEVVDVGAGAAVLGHPASSVAMLANLLAERGEHI 226
                                         *************************************************************************** PP

                           TIGR03218 227 PaGslilsggiteavavaaGdsvtvrvqelgsvslrf 263
                                         PaG++i++ggit+a++v++Gd++tvr+q+lg+vs+rf
  lcl|FitnessBrowser__Marino:GFF1138 227 PAGTFIMTGGITAAITVEPGDNITVRYQGLGTVSARF 263
                                         ************************************9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (263 nodes)
Target sequences:                          1  (264 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 6.83
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory