Align 4-oxalocrotonate decarboxylase subunit (EC 4.1.1.77) (characterized)
to candidate GFF4097 HP15_4037 hydratase/decarboxylase
Query= metacyc::MONOMER-12752 (264 letters) >lcl|FitnessBrowser__Marino:GFF4097 HP15_4037 hydratase/decarboxylase Length = 264 Score = 461 bits (1186), Expect = e-135 Identities = 226/263 (85%), Positives = 249/263 (94%) Query: 1 MNRTLNREQVLALAEHIENAELQAHDIHKVTNDYPEMTFADAYTIQWEIRRRKEERGNKI 60 M++TLN+EQVLALAEH+ENAELQAHDI KVTND+P+MTF DAY +QWEIRRRKE RGNKI Sbjct: 1 MSKTLNQEQVLALAEHVENAELQAHDITKVTNDFPDMTFEDAYDVQWEIRRRKEARGNKI 60 Query: 61 VGLKMGLTSWAKMAQMGVETPIYGFLADYFSVPDGGVVDCSKLIHPKIEAEIAVVTKAPL 120 VG+KMGLTSWAKMAQMGVETPIYGFLADYFSVPDGGVV+ +LIHPKIEAEIA VTKAPL Sbjct: 61 VGMKMGLTSWAKMAQMGVETPIYGFLADYFSVPDGGVVNTKELIHPKIEAEIAFVTKAPL 120 Query: 121 VGPGCHIGDVIAAVDYVIPTVEVIDSRYENFKFDLISVVADNASSTRYITGGRMANLEDV 180 GPGCHIG V+AA D+VIP VEVIDSRYENFKFDL+SVVADNASSTR+ITGG+MA++ DV Sbjct: 121 KGPGCHIGQVLAATDFVIPAVEVIDSRYENFKFDLVSVVADNASSTRFITGGQMADVADV 180 Query: 181 DLRTLGVVMEKNGEVVELGAGAAVLGHPLSSVAMLANLLAERGEHIPAGTFIMTGGITAA 240 DL+TLGVV+EKNGEVV++GAGAAVLGHP SSVAMLANLLAERGEHIPAGTFIMTGGITAA Sbjct: 181 DLKTLGVVVEKNGEVVDVGAGAAVLGHPASSVAMLANLLAERGEHIPAGTFIMTGGITAA 240 Query: 241 VAVAPGDNITVRYQGLGSVSARF 263 +AV PGDNITVRYQGLG+VSARF Sbjct: 241 IAVEPGDNITVRYQGLGTVSARF 263 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 264 Length adjustment: 25 Effective length of query: 239 Effective length of database: 239 Effective search space: 57121 Effective search space used: 57121 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate GFF4097 HP15_4037 (hydratase/decarboxylase)
to HMM TIGR03218 (dmpH: 4-oxalocrotonate decarboxylase (EC 4.1.1.77))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03218.hmm # target sequence database: /tmp/gapView.11633.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03218 [M=263] Accession: TIGR03218 Description: catechol_dmpH: 4-oxalocrotonate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-155 501.5 1.6 2.7e-155 501.3 1.6 1.0 1 lcl|FitnessBrowser__Marino:GFF4097 HP15_4037 hydratase/decarboxylas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF4097 HP15_4037 hydratase/decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 501.3 1.6 2.7e-155 2.7e-155 2 263 .] 2 263 .. 1 263 [. 0.99 Alignments for each domain: == domain 1 score: 501.3 bits; conditional E-value: 2.7e-155 TIGR03218 2 eltltreqiealaehvenaeleareitkitdeyPdldfadaydiqaeirrrklarGakvvGlkaGltskakmkqm 76 +tl++eq+ alaehvenael+a++itk+t+++Pd++f+dayd+q+eirrrk+arG+k+vG+k+Glts+akm+qm lcl|FitnessBrowser__Marino:GFF4097 2 SKTLNQEQVLALAEHVENAELQAHDITKVTNDFPDMTFEDAYDVQWEIRRRKEARGNKIVGMKMGLTSWAKMAQM 76 689************************************************************************ PP TIGR03218 77 GvetpvfGfladyfsvpdggeiktselihPkveaeiafvlkaelkgpgchigdvlaatdfvlpavevidsrykdf 151 Gvetp++Gfladyfsvpdgg ++t+elihPk+eaeiafv+ka+lkgpgchig+vlaatdfv+pavevidsry++f lcl|FitnessBrowser__Marino:GFF4097 77 GVETPIYGFLADYFSVPDGGVVNTKELIHPKIEAEIAFVTKAPLKGPGCHIGQVLAATDFVIPAVEVIDSRYENF 151 *************************************************************************** PP TIGR03218 152 kfdlksvvadnassarfvtGgraaavedldlrtlGvvleknGevvalgagaavlGhpaaavamlanllaergeei 226 kfdl svvadnass+rf+tGg++a+v+d+dl+tlGvv+eknGevv++gagaavlGhpa++vamlanllaerge+i lcl|FitnessBrowser__Marino:GFF4097 152 KFDLVSVVADNASSTRFITGGQMADVADVDLKTLGVVVEKNGEVVDVGAGAAVLGHPASSVAMLANLLAERGEHI 226 *************************************************************************** PP TIGR03218 227 PaGslilsggiteavavaaGdsvtvrvqelgsvslrf 263 PaG++i++ggit+a+av++Gd++tvr+q+lg+vs+rf lcl|FitnessBrowser__Marino:GFF4097 227 PAGTFIMTGGITAAIAVEPGDNITVRYQGLGTVSARF 263 ************************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (264 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.69 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory