Align catechol 2,3-dioxygenase (EC 1.13.11.2) (characterized)
to candidate GFF1132 HP15_1110 catechol 2,3-dioxygenase
Query= BRENDA::P06622 (307 letters) >FitnessBrowser__Marino:GFF1132 Length = 290 Score = 492 bits (1266), Expect = e-144 Identities = 229/290 (78%), Positives = 252/290 (86%) Query: 18 MSKALEHYVELLGLIEMDRDDQGRVYLKAWTEVDKFSLVLREADEPGMDFMGFKVVDEDA 77 M +AL+HY +LLGLIE DRDDQGRVYLKAW+EVDKFS+VLREADEPG DFM FKV+DED Sbjct: 1 MDEALQHYTDLLGLIETDRDDQGRVYLKAWSEVDKFSVVLREADEPGCDFMAFKVLDEDT 60 Query: 78 LRQLERDLMAYGCAVEQLPAGELNSCGRRVRFQAPSGHHFELYADKEYTGKWGLNDVNPE 137 L QLE+DL+ +G VEQ+PA EL CGRRVRF PSGH FEL+ADK+YTGKWGL+ VNPE Sbjct: 61 LNQLEKDLVTFGVEVEQVPAEELKDCGRRVRFTVPSGHAFELFADKKYTGKWGLSSVNPE 120 Query: 138 AWPRDLKGMAAVRFDHALMYGDELPATYDLFTKVLGFYLAEQVLDENGTRVAQFLSLSTK 197 AWPR L+GM AVRFDH L YG EL A YD+F VLGF LAEQVLD GTRV+QFL++S K Sbjct: 121 AWPRGLRGMKAVRFDHCLFYGPELAAVYDIFVNVLGFDLAEQVLDPQGTRVSQFLTVSMK 180 Query: 198 AHDVAFIHHPEKGRLHHVSFHLETWEDLLRAADLISMTDTSIDIGPTRHGLTHGKTIYFF 257 HD+AFIHH E G+ HH SFHLETWED+LRAADLI+MTDTSIDIGPTRHGLTHGKTIYFF Sbjct: 181 EHDIAFIHHEEPGKFHHASFHLETWEDVLRAADLITMTDTSIDIGPTRHGLTHGKTIYFF 240 Query: 258 DPSGNRNEVFCGGDYNYPDHKPVTWTTDQLGKAIFYHDRILNERFMTVLT 307 DPSGNRNEVFCGGDY YPDHKPVTWTTD+LGKAIFYHDR LNERFM VLT Sbjct: 241 DPSGNRNEVFCGGDYFYPDHKPVTWTTDELGKAIFYHDRTLNERFMAVLT 290 Lambda K H 0.322 0.139 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 290 Length adjustment: 27 Effective length of query: 280 Effective length of database: 263 Effective search space: 73640 Effective search space used: 73640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate GFF1132 HP15_1110 (catechol 2,3-dioxygenase)
to HMM TIGR03211 (catechol 2,3 dioxygenase (EC 1.13.11.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03211.hmm # target sequence database: /tmp/gapView.23131.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03211 [M=303] Accession: TIGR03211 Description: catechol_2_3: catechol 2,3 dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-126 405.6 0.1 7.3e-126 405.5 0.1 1.0 1 lcl|FitnessBrowser__Marino:GFF1132 HP15_1110 catechol 2,3-dioxygena Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF1132 HP15_1110 catechol 2,3-dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 405.5 0.1 7.3e-126 7.3e-126 15 303 .] 1 290 [] 1 290 [] 0.99 Alignments for each domain: == domain 1 score: 405.5 bits; conditional E-value: 7.3e-126 TIGR03211 15 leealkfykdvlGleetgrdeq.svYlkawdewdkysvilteadkagldhvafkveseadLeklekkleaaGvev 88 ++eal++y+d+lGl et+rd+q +vYlkaw e+dk+sv+l+ead++g d++afkv +e++L++lek+l +Gvev lcl|FitnessBrowser__Marino:GFF1132 1 MDEALQHYTDLLGLIETDRDDQgRVYLKAWSEVDKFSVVLREADEPGCDFMAFKVLDEDTLNQLEKDLVTFGVEV 75 79************************************************************************* PP TIGR03211 89 erieagedlevGeavrfelPsgheleLyaekelvg.ekkgklnpdpwkkelkGvaakrldHvlllaedveenvkl 162 e+++a+e++++G++vrf++Psgh +eL+a+k+++g + +++np++w+++l+G++a r+dH+l++++++++ ++ lcl|FitnessBrowser__Marino:GFF1132 76 EQVPAEELKDCGRRVRFTVPSGHAFELFADKKYTGkWGLSSVNPEAWPRGLRGMKAVRFDHCLFYGPELAAVYDI 150 *********************************88689************************************* PP TIGR03211 163 ltevLgfkltEqvvaedgkeqlaaflsvsnkahdiafvkdpekgklhHvsflldswedvlkaaDvlskndvkidv 237 + +vLgf l+Eqv++++g++ +++fl+vs k hdiaf++++e+gk+hH+sf l++wedvl+aaD+++++d++id+ lcl|FitnessBrowser__Marino:GFF1132 151 FVNVLGFDLAEQVLDPQGTR-VSQFLTVSMKEHDIAFIHHEEPGKFHHASFHLETWEDVLRAADLITMTDTSIDI 224 ****************9996.****************************************************** PP TIGR03211 238 gptrHgitrgqtiYvfdPsGnrvElfaggylaypdwepitWtedelgrgifyherklnesfltvlt 303 gptrHg+t+g+tiY+fdPsGnr+E+f+gg + ypd++p+tWt+delg++ifyh+r+lne+f+ vlt lcl|FitnessBrowser__Marino:GFF1132 225 GPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYFYPDHKPVTWTTDELGKAIFYHDRTLNERFMAVLT 290 **************************************************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (303 nodes) Target sequences: 1 (290 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.50 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory