Align catechol 2,3-dioxygenase (EC 1.13.11.2) (characterized)
to candidate GFF1132 HP15_1110 catechol 2,3-dioxygenase
Query= BRENDA::P06622 (307 letters) >FitnessBrowser__Marino:GFF1132 Length = 290 Score = 492 bits (1266), Expect = e-144 Identities = 229/290 (78%), Positives = 252/290 (86%) Query: 18 MSKALEHYVELLGLIEMDRDDQGRVYLKAWTEVDKFSLVLREADEPGMDFMGFKVVDEDA 77 M +AL+HY +LLGLIE DRDDQGRVYLKAW+EVDKFS+VLREADEPG DFM FKV+DED Sbjct: 1 MDEALQHYTDLLGLIETDRDDQGRVYLKAWSEVDKFSVVLREADEPGCDFMAFKVLDEDT 60 Query: 78 LRQLERDLMAYGCAVEQLPAGELNSCGRRVRFQAPSGHHFELYADKEYTGKWGLNDVNPE 137 L QLE+DL+ +G VEQ+PA EL CGRRVRF PSGH FEL+ADK+YTGKWGL+ VNPE Sbjct: 61 LNQLEKDLVTFGVEVEQVPAEELKDCGRRVRFTVPSGHAFELFADKKYTGKWGLSSVNPE 120 Query: 138 AWPRDLKGMAAVRFDHALMYGDELPATYDLFTKVLGFYLAEQVLDENGTRVAQFLSLSTK 197 AWPR L+GM AVRFDH L YG EL A YD+F VLGF LAEQVLD GTRV+QFL++S K Sbjct: 121 AWPRGLRGMKAVRFDHCLFYGPELAAVYDIFVNVLGFDLAEQVLDPQGTRVSQFLTVSMK 180 Query: 198 AHDVAFIHHPEKGRLHHVSFHLETWEDLLRAADLISMTDTSIDIGPTRHGLTHGKTIYFF 257 HD+AFIHH E G+ HH SFHLETWED+LRAADLI+MTDTSIDIGPTRHGLTHGKTIYFF Sbjct: 181 EHDIAFIHHEEPGKFHHASFHLETWEDVLRAADLITMTDTSIDIGPTRHGLTHGKTIYFF 240 Query: 258 DPSGNRNEVFCGGDYNYPDHKPVTWTTDQLGKAIFYHDRILNERFMTVLT 307 DPSGNRNEVFCGGDY YPDHKPVTWTTD+LGKAIFYHDR LNERFM VLT Sbjct: 241 DPSGNRNEVFCGGDYFYPDHKPVTWTTDELGKAIFYHDRTLNERFMAVLT 290 Lambda K H 0.322 0.139 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 290 Length adjustment: 27 Effective length of query: 280 Effective length of database: 263 Effective search space: 73640 Effective search space used: 73640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate GFF1132 HP15_1110 (catechol 2,3-dioxygenase)
to HMM TIGR03211 (catechol 2,3 dioxygenase (EC 1.13.11.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03211.hmm # target sequence database: /tmp/gapView.5082.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03211 [M=303] Accession: TIGR03211 Description: catechol_2_3: catechol 2,3 dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-126 405.6 0.1 7.3e-126 405.5 0.1 1.0 1 lcl|FitnessBrowser__Marino:GFF1132 HP15_1110 catechol 2,3-dioxygena Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF1132 HP15_1110 catechol 2,3-dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 405.5 0.1 7.3e-126 7.3e-126 15 303 .] 1 290 [] 1 290 [] 0.99 Alignments for each domain: == domain 1 score: 405.5 bits; conditional E-value: 7.3e-126 TIGR03211 15 leealkfykdvlGleetgrdeq.svYlkawdewdkysvilteadkagldhvafkveseadLeklekkleaaGvev 88 ++eal++y+d+lGl et+rd+q +vYlkaw e+dk+sv+l+ead++g d++afkv +e++L++lek+l +Gvev lcl|FitnessBrowser__Marino:GFF1132 1 MDEALQHYTDLLGLIETDRDDQgRVYLKAWSEVDKFSVVLREADEPGCDFMAFKVLDEDTLNQLEKDLVTFGVEV 75 79************************************************************************* PP TIGR03211 89 erieagedlevGeavrfelPsgheleLyaekelvg.ekkgklnpdpwkkelkGvaakrldHvlllaedveenvkl 162 e+++a+e++++G++vrf++Psgh +eL+a+k+++g + +++np++w+++l+G++a r+dH+l++++++++ ++ lcl|FitnessBrowser__Marino:GFF1132 76 EQVPAEELKDCGRRVRFTVPSGHAFELFADKKYTGkWGLSSVNPEAWPRGLRGMKAVRFDHCLFYGPELAAVYDI 150 *********************************88689************************************* PP TIGR03211 163 ltevLgfkltEqvvaedgkeqlaaflsvsnkahdiafvkdpekgklhHvsflldswedvlkaaDvlskndvkidv 237 + +vLgf l+Eqv++++g++ +++fl+vs k hdiaf++++e+gk+hH+sf l++wedvl+aaD+++++d++id+ lcl|FitnessBrowser__Marino:GFF1132 151 FVNVLGFDLAEQVLDPQGTR-VSQFLTVSMKEHDIAFIHHEEPGKFHHASFHLETWEDVLRAADLITMTDTSIDI 224 ****************9996.****************************************************** PP TIGR03211 238 gptrHgitrgqtiYvfdPsGnrvElfaggylaypdwepitWtedelgrgifyherklnesfltvlt 303 gptrHg+t+g+tiY+fdPsGnr+E+f+gg + ypd++p+tWt+delg++ifyh+r+lne+f+ vlt lcl|FitnessBrowser__Marino:GFF1132 225 GPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYFYPDHKPVTWTTDELGKAIFYHDRTLNERFMAVLT 290 **************************************************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (303 nodes) Target sequences: 1 (290 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.54 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory