Align catechol 2,3-dioxygenase (EC 1.13.11.2) (characterized)
to candidate GFF4091 HP15_4031 catechol 2,3-dioxygenase
Query= BRENDA::Q8KLV4 (307 letters) >FitnessBrowser__Marino:GFF4091 Length = 307 Score = 539 bits (1388), Expect = e-158 Identities = 251/307 (81%), Positives = 275/307 (89%) Query: 1 MKKGVLRPGHIQLRVLNLESALAHYRDLLGLIEVDRDDFGRVYLKAWTEVDKFSLVLREA 60 MKKGV+RPGH+Q+RVL+++ AL HY DLLGLIE DRDD GRVYLKAWTEVDKFS+VLR A Sbjct: 1 MKKGVMRPGHVQIRVLDMDEALKHYTDLLGLIETDRDDHGRVYLKAWTEVDKFSVVLRPA 60 Query: 61 DEPGMDFMGFKVVDEDALRQLERDLMAYGCAVEQLPAGELNSCGRRVRFQAPSGHHFELY 120 DEPGMDFM FKVVDE +L+QLE+DL +G VEQ+P GEL CGRRVRF APSGH FELY Sbjct: 61 DEPGMDFMAFKVVDEASLQQLEKDLADHGVEVEQVPEGELKDCGRRVRFNAPSGHTFELY 120 Query: 121 ADKEYTGKWGVNEVNPEAWPRDLKGMAAVRFDHALMYGDELPATYDLFTKVLGFYLAEQV 180 ADK+YTGKWG+ EVNPEAWPR L GM AVRFDH L+YG EL ATYDLF VLGFYLAEQV Sbjct: 121 ADKKYTGKWGITEVNPEAWPRGLDGMKAVRFDHCLLYGPELAATYDLFVNVLGFYLAEQV 180 Query: 181 LDENGTRVAQFLSLSTKAHDVAFIHHPEKGRLHHVSFHLETWEDVLRAADLISMTDTSID 240 LD +GTR+AQFL+LSTKAHD+AFIHH EKG+ HH SF+LETWEDVLRAADLISMTDTSID Sbjct: 181 LDGDGTRIAQFLTLSTKAHDIAFIHHEEKGKFHHASFYLETWEDVLRAADLISMTDTSID 240 Query: 241 IGPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYNYPDHKPVTWTTDQLGKAIFYHDRILNE 300 IGPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYNYPDHKPVTW +QLGKAIFYHDR+LNE Sbjct: 241 IGPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYNYPDHKPVTWQAEQLGKAIFYHDRVLNE 300 Query: 301 RFMTVLT 307 RF+TVLT Sbjct: 301 RFLTVLT 307 Lambda K H 0.322 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 474 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 307 Length adjustment: 27 Effective length of query: 280 Effective length of database: 280 Effective search space: 78400 Effective search space used: 78400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate GFF4091 HP15_4031 (catechol 2,3-dioxygenase)
to HMM TIGR03211 (catechol 2,3 dioxygenase (EC 1.13.11.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03211.hmm # target sequence database: /tmp/gapView.16723.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03211 [M=303] Accession: TIGR03211 Description: catechol_2_3: catechol 2,3 dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-139 448.7 0.1 5.5e-139 448.6 0.1 1.0 1 lcl|FitnessBrowser__Marino:GFF4091 HP15_4031 catechol 2,3-dioxygena Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF4091 HP15_4031 catechol 2,3-dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 448.6 0.1 5.5e-139 5.5e-139 1 303 [] 4 307 .] 4 307 .] 0.99 Alignments for each domain: == domain 1 score: 448.6 bits; conditional E-value: 5.5e-139 TIGR03211 1 gvlrlghvelrvldleealkfykdvlGleetgrdeq.svYlkawdewdkysvilteadkagldhvafkveseadL 74 gv+r+ghv++rvld++ealk+y+d+lGl et+rd++ +vYlkaw+e+dk+sv+l++ad++g+d++afkv +ea+L lcl|FitnessBrowser__Marino:GFF4091 4 GVMRPGHVQIRVLDMDEALKHYTDLLGLIETDRDDHgRVYLKAWTEVDKFSVVLRPADEPGMDFMAFKVVDEASL 78 69************************************************************************* PP TIGR03211 75 eklekkleaaGveverieagedlevGeavrfelPsgheleLyaekelvg.ekkgklnpdpwkkelkGvaakrldH 148 ++lek+l + Gveve++++ge++++G++vrf++Psgh++eLya+k+++g + +++np++w+++l G++a r+dH lcl|FitnessBrowser__Marino:GFF4091 79 QQLEKDLADHGVEVEQVPEGELKDCGRRVRFNAPSGHTFELYADKKYTGkWGITEVNPEAWPRGLDGMKAVRFDH 153 ***********************************************886899********************** PP TIGR03211 149 vlllaedveenvklltevLgfkltEqvvaedgkeqlaaflsvsnkahdiafvkdpekgklhHvsflldswedvlk 223 +ll++++++++ +l+ +vLgf+l+Eqv+++dg++ +a+fl++s+kahdiaf++++ekgk+hH+sf+l++wedvl+ lcl|FitnessBrowser__Marino:GFF4091 154 CLLYGPELAATYDLFVNVLGFYLAEQVLDGDGTR-IAQFLTLSTKAHDIAFIHHEEKGKFHHASFYLETWEDVLR 227 *********************************6.**************************************** PP TIGR03211 224 aaDvlskndvkidvgptrHgitrgqtiYvfdPsGnrvElfaggylaypdwepitWtedelgrgifyherklnesf 298 aaD++s++d++id+gptrHg+t+g+tiY+fdPsGnr+E+f+gg ++ypd++p+tW++++lg++ifyh+r+lne+f lcl|FitnessBrowser__Marino:GFF4091 228 AADLISMTDTSIDIGPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYNYPDHKPVTWQAEQLGKAIFYHDRVLNERF 302 *************************************************************************** PP TIGR03211 299 ltvlt 303 ltvlt lcl|FitnessBrowser__Marino:GFF4091 303 LTVLT 307 **987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (303 nodes) Target sequences: 1 (307 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.63 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory