Align The 11 TMS Na+-dependent tyrosine transporter, Tyt1 (characterized)
to candidate GFF3976 HP15_3916 sodium-dependent transporter family protein
Query= TCDB::Q8RHM5 (438 letters) >FitnessBrowser__Marino:GFF3976 Length = 465 Score = 189 bits (481), Expect = 1e-52 Identities = 138/450 (30%), Positives = 216/450 (48%), Gaps = 38/450 (8%) Query: 8 FQSKIGFILTCVGSAVGMANIWAFPYRVGKYGGAVFLLIYFMFIALFSYVGLSAEYLIGR 67 + S++ FIL GSAVG+ NIW FPY G+ GG F+L+Y + IA+ + AE IGR Sbjct: 19 WSSRLAFILAATGSAVGLGNIWKFPYVTGENGGGAFVLVYLLCIAVIGIPIMMAEVFIGR 78 Query: 68 RAETGTLGSYEYAWKDVGKGKLGYGL-AYIPLLGSMSIAIGYAVIAAWVLRTFGAAVTGK 126 + S + G+ + A I ++ + I Y+VI W G A G Sbjct: 79 NGRHNPITSMRLV-AERNLSAPGWRISAIIGMIAAFVILSFYSVIGGWAASYVGHAAMGD 137 Query: 127 ILEVDTAQFFGEAVTGNFV----IMPWHIAVIVLTLLTLFAGAKS-IEKTNKIMMPAFFV 181 TA GE G ++ WH + L +L + G K +E+ I+MPA F+ Sbjct: 138 FTG-GTADSIGELFGGLLASPGQLLLWHTIFMALVILVVSQGLKGGLERAVTILMPALFL 196 Query: 182 LFFILAVRVAFLPGAI-EGYKYLFVPDWSYLSNVETWINAMGQAFFSLSITGSGMIVCGA 240 L + AV A G E +LF PD+ L+ + + A+G AFF+LS+ + M+ G+ Sbjct: 197 LLLV-AVGYATTTGHFGEAVSFLFTPDFGALT-INGVLIALGHAFFTLSLGMAIMMAYGS 254 Query: 241 YLDKKEDIINGALQTGVFDTIAAMIAAFVVIPASFAFGYPASAGPSLMFMTIPEVFKQMP 300 YL + I A+ + DT+ A++A + P FA G A AGP L+F T+P F MP Sbjct: 255 YLGRDVSIGRTAVSVAIMDTVVALLAGLAIFPVVFANGLEAGAGPGLIFQTLPLAFGNMP 314 Query: 301 FGQLLAILFFVSVVFAAISSLQNMFEVVGESIQTRFKMTRKSVIVLLGIIALVIGIFIEP 360 G L LFF+ ++FAA +S ++ E V E ++ + + R +L+G++ +G I Sbjct: 315 MGGLFGTLFFILLLFAAWTSGISLLEPVVEWVEEKTSLARTGSSILVGVLCWALG--IAS 372 Query: 361 ENKVGPWMDVV-----------TIY----------IIPFGAVLGAISWYWILKKESYMEE 399 + W DV TI+ ++P +L A+ W + KES + Sbjct: 373 ILSLNVWADVAPLAMFERFEGKTIFDLLDFFTANVLLPLSGLLTAVFVGWFVAKESLKSD 432 Query: 400 LN-QGSKVTRSEIYHNVGKYVYVPLVLVVF 428 L QG T +++N+ ++V V +VF Sbjct: 433 LALQGGAFT---LWYNLIRFVTPIAVAIVF 459 Lambda K H 0.328 0.143 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 598 Number of extensions: 38 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 465 Length adjustment: 33 Effective length of query: 405 Effective length of database: 432 Effective search space: 174960 Effective search space used: 174960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory