Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate GFF930 HP15_909 enoyl-CoA hydratase/isomerase family protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_4790 (356 letters) >FitnessBrowser__Marino:GFF930 Length = 356 Score = 232 bits (591), Expect = 1e-65 Identities = 129/335 (38%), Positives = 190/335 (56%), Gaps = 8/335 (2%) Query: 21 LNRPAGLNAITLDMVRSLQQQLDAWAQDPQVHAVVLRGAGEKAFCAGGDIRSLYDSFKS- 79 LN P LN+++L+M+R L QL WA+DP + AV L G+KAFCAGGDI +LY S Sbjct: 24 LNTPKALNSLSLEMIRLLTPQLKRWAEDPVIQAVWLESEGDKAFCAGGDIVALYRSMTEP 83 Query: 80 -GDTLHEDFFVEEYALDLAIHHYRKPVLALMDGFVLGGGMGLVQGADLRVVTERSRLAMP 138 G + E FF EEY LD IH + KP++ G V+GGGMG+++GA RVVTE S+LAMP Sbjct: 84 QGASEGEAFFTEEYELDYLIHTFPKPLVCWGHGIVMGGGMGIMEGASHRVVTEGSKLAMP 143 Query: 139 EVAIGYFPDVGGSHFLPRVPGELGIYLGVSGVQIRAADALYCGLADWYLESNKLGTLDEQ 198 E+ IG +PDV FL R PG G++LG++G ++ ADA++ GLAD ++ + + + Sbjct: 144 EITIGLYPDVAAGWFLNRTPGRTGLFLGLTGARLNGADAIFTGLADRFIRHDLKADVIAE 203 Query: 199 LDQLQWH-ETPLKDLQGLLAKLAVQQLPAAPLAALRPAIDHFFALPDVPSM---VEQLRA 254 L + W E P + +L + + A P + +R D + D S+ V QL+ Sbjct: 204 LCKRNWQGEDPHAVVGSVLRRYERESADAMPESPVRTHFDEINRVTDADSLEATVNQLKE 263 Query: 255 VTVADSHEWATATADLLESRSPLAMGVTLEMLRRGRHLSLEQCFALELHLDRQWFERGDL 314 ++ D W L SP ++ + L +H SL++ EL L + +G+ Sbjct: 264 LSGGDG--WVAKATRSLAGASPTSLALVWRHLHGCKHDSLKEVLDKELVLSTKCLTKGEF 321 Query: 315 IEGVRALLIDKDKNPRWSPPTLQALDAGHVASFFT 349 EG+RALLIDKD+ PRW +L +D+ + FF+ Sbjct: 322 AEGIRALLIDKDQQPRWRYASLAEMDSAWIDDFFS 356 Lambda K H 0.322 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 356 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 356 Length adjustment: 29 Effective length of query: 327 Effective length of database: 327 Effective search space: 106929 Effective search space used: 106929 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory