GapMind for catabolism of small carbon sources

 

Aligments for a candidate for dddA in Marinobacter adhaerens HP15

Align 3-hydroxypropionate dehydrogenase (EC 1.1.1.59) (characterized)
to candidate GFF3683 HP15_3625 choline dehydrogenase

Query= metacyc::MONOMER-15202
         (579 letters)



>lcl|FitnessBrowser__Marino:GFF3683 HP15_3625 choline dehydrogenase
          Length = 561

 Score =  365 bits (936), Expect = e-105
 Identities = 219/541 (40%), Positives = 305/541 (56%), Gaps = 19/541 (3%)

Query: 36  FDYIVVGAGTAGCLLANRLSADPANRVLLIEAGGRDNYHWIHIPVGYLYCINNPRTDWRF 95
           +DYI+VGAG+AGC+LANRL+ D  +RVLL+E GG D   +I +P      +N  +  W+F
Sbjct: 6   YDYIIVGAGSAGCVLANRLTEDARHRVLLLETGGSDKSIFIQMPTALSIPMNTKKYAWQF 65

Query: 96  RTEPDPGLNGRSLIYPRGKTLGGCSSINGMLYLRGQARDYDGWAELTGDDAWRWDNCLPD 155
            TEP+P L+ R +  PRGK LGG SSINGM+Y+RG ARD+D W +  G   W + N LP 
Sbjct: 66  ETEPEPFLDNRRMHCPRGKVLGGSSSINGMVYVRGHARDFDEW-DSEGATGWHYRNVLPY 124

Query: 156 FMRHEDHYRLDEGGDADPDHYKFHGHGGEWRIEK-QRLKWQVLADFATAAVEAGVPRTRD 214
           F + E       GG+       + G  G   +     ++  +   F  A  +AG   T D
Sbjct: 125 FRKAE---TWAFGGN------DYRGDKGPLGVNNGNNMQNPLYKAFIRAGSDAGYFETDD 175

Query: 215 FNRGDNEGVDAFEVNQRSGWRWNASKAFLRGVEQRGNLTVWHSTQVLKLDFASGEGSEPR 274
           +N    EG  A  +  ++G RW+ + A+LR    R NLTV     V K+    G+     
Sbjct: 176 YNGTQQEGFGAMHMTVKNGRRWSTANAYLRPAMDRDNLTVVTHALVHKV-LLDGK----T 230

Query: 275 CCGVTVERAGKKVVTTARCEVVLSAGAIGSPQLLQLSGIGPTALLAEHAIPVVADLPGVG 334
             GV  E+ GK     A  EV+LSAG+IGSP LLQLSGIG   +L +  I V  +LPGVG
Sbjct: 231 ATGVRYEQGGKVHEAKAAEEVILSAGSIGSPHLLQLSGIGKREVLEKAGIEVKHELPGVG 290

Query: 335 ENLQDHLQIRSIYKVKGAKTLNTMANSLIGKAKIGLEYILKRSGPMSMAPSQLCIFTRSS 394
           ENLQDHL+    Y+ K   +LN   +    K KIG+ +IL++ G  +    + C F RS 
Sbjct: 291 ENLQDHLEFYFQYRCKQPVSLNGKLD-WWNKLKIGVRWILRKDGLGATNHFESCGFIRSK 349

Query: 395 KEYEHPNLEYHVQPLSLEAFGQPLHDFPAITASVCNLNPTSRGTVRIKSGNPRQAPAISP 454
              E P+L+YH  P ++   G+   +       + +  P SRG V ++S +P+QAP I  
Sbjct: 350 AGVEWPDLQYHFLPAAMRYDGKEAFNGDGFQLHIGHNKPKSRGFVHVQSADPKQAPTIRF 409

Query: 455 NYLSTEEDRQVAADSLRVTRHIASQPAFAKYDPEEFKPGVQYQSDEDLARLAGDIGTTIF 514
           NYL  E DR+   D +R+TR I +QPA  +Y   E +PG + Q+DE++         + +
Sbjct: 410 NYLQHEADREGFRDCVRLTREIINQPAMDEYRGAEIQPGAEVQTDEEIDAFVRQAVESAY 469

Query: 515 HPVGTAKMGRDDDPMAVVDSHLRVRGVTGLRVVDASIMPTITSGNTNSPTLMIAEKAAGW 574
           HP  + KMG D+  +AVVD   RV G+  LRVVD+SI PTI +GN NSPT+M+AE+AA  
Sbjct: 470 HPSCSCKMGTDE--LAVVDPETRVHGIRNLRVVDSSIFPTIPNGNLNSPTIMVAERAADL 527

Query: 575 I 575
           I
Sbjct: 528 I 528


Lambda     K      H
   0.318    0.135    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 970
Number of extensions: 53
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 579
Length of database: 561
Length adjustment: 36
Effective length of query: 543
Effective length of database: 525
Effective search space:   285075
Effective search space used:   285075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory