Align branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) (characterized)
to candidate GFF2762 HP15_2706 inner-membrane translocator
Query= ecocyc::LIVH-MONOMER (308 letters) >FitnessBrowser__Marino:GFF2762 Length = 291 Score = 181 bits (459), Expect = 2e-50 Identities = 103/302 (34%), Positives = 173/302 (57%), Gaps = 16/302 (5%) Query: 8 FLQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVSFMIIAALMMMGID 67 FLQ +F G+T+G+TYALIA+G+T++Y +INFA GE MIG M +L MG+ Sbjct: 5 FLQYLFTGITIGATYALIALGFTLIYNASHVINFAQGEFLMIGG----MATVSLTAMGVP 60 Query: 68 TGWLLVAAGFVGAIVIASAYGWSIERVAYRPVRNSKRLIALISAIGMSIFLQNYVSLTEG 127 + V A+++A G +++R A P + + + +I IG SIF++ + G Sbjct: 61 -----MILAVVLAVILAGILGVALQRFAIAPAKQADVVTLIIITIGASIFIRGIAQVVWG 115 Query: 128 SRDVALPSLFNGQWVVGHSENFSASITTMQAVIWIVTFLAMLALTIFIRYSRMGRACRAC 187 + + Q + E F A + + + + + ++ L +F + +G+A A Sbjct: 116 KEYHVMQNFSTDQPI----EVFGAVLNSQSLWVLGIGAILVVGLVLFFTKTLIGKAILAT 171 Query: 188 AEDLKMASLLGINTDRVIALTFVIGAAMAAVAGVLLGQFYGVINPY-IGFMAGMKAFTAA 246 + + + A L+GI T V+ L F++ A + +VAG+++ Y IG + G+K F AA Sbjct: 172 SMNKEAARLVGIRTQMVLMLAFMVSALLGSVAGIVVAPI--TFTSYDIGIILGLKGFVAA 229 Query: 247 VLGGIGSIPGAMIGGLILGIAEALSSAYLSTEYKDVVSFALLILVLLVMPTGILGRPEVE 306 +GG+GS GA++GGL LGI EA+++ Y+S++YKD V+F++++LVL MP G+ G VE Sbjct: 230 AIGGLGSGVGAVVGGLSLGIVEAMAAGYISSDYKDAVAFSMILLVLFFMPRGLFGAKVVE 289 Query: 307 KV 308 +V Sbjct: 290 RV 291 Lambda K H 0.328 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 291 Length adjustment: 27 Effective length of query: 281 Effective length of database: 264 Effective search space: 74184 Effective search space used: 74184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory