Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate GFF2761 HP15_2705 inner-membrane translocator
Query= TCDB::Q8DQH9 (318 letters) >FitnessBrowser__Marino:GFF2761 Length = 335 Score = 199 bits (507), Expect = 6e-56 Identities = 126/316 (39%), Positives = 178/316 (56%), Gaps = 27/316 (8%) Query: 20 SLISVLVSVGVLNLFYVQILQQIGINIILAVGLNLIVGFSGQFSLGHAGFMAIGAYAAAI 79 +LI V++ + N F+ +++ Q+ I VGLNL+VGF+GQ SLGHAGF +GAY Sbjct: 17 ALILVILPAFLGNPFHYELVTQMAIIAATVVGLNLLVGFAGQISLGHAGFFGLGAY---F 73 Query: 80 IGSKSPTYG-AFFGAMLVGALLSGAVALLVGIPTLRLKGDYLAVATLGVSEIIRIFIING 138 G + TYG + A++VGA++ GA+A +VG P LRLKG YL++ATL V II I + N Sbjct: 74 TGIATGTYGWSSVPALVVGAIVVGAIAWIVGRPILRLKGHYLSMATLAVGFIIAIILNNE 133 Query: 139 GSLTNGAAGI----------------------LGIPNFTTWQMVYFFVVITTI-ATLNFL 175 +LT G G+ + I F W + V++ + LN + Sbjct: 134 RALTGGPDGMPVPAFEIFGWELSAFGRYSLFGITIEGFQAWYIFASVVLLVAVWFALNLI 193 Query: 176 RSPIGRSTLSVREDEIAAESVGVNTTKIKIIAFVFGAITASIAGSLQAGFIGSVVPKDYT 235 SPIGR+ SV E+AA VGVNT K K + FV AI AS+ GSL A F G + P + Sbjct: 194 ESPIGRALRSVHGSEVAASVVGVNTAKYKSLVFVISAIYASLMGSLYAHFQGFITPAVAS 253 Query: 236 FINSINVLIIVVFGGLGSITGAIVSAIVLGILNMLLQDVASVRMIIYALALVLVMIFRPG 295 F SI + +VV GG+GS G I+ A+VL +L +L D + +++ L L+L MIF P Sbjct: 254 FEFSILFITMVVLGGMGSTFGVILGAVVLKLLPQVLADFQELEHVMFGLILMLTMIFMPK 313 Query: 296 GLLGTWELSLSRFFKK 311 GLL T +S+ +K Sbjct: 314 GLLPTLTAFVSKKMRK 329 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 335 Length adjustment: 28 Effective length of query: 290 Effective length of database: 307 Effective search space: 89030 Effective search space used: 89030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory