Align 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (characterized)
to candidate GFF1553 HP15_1515 6-phosphogluconate dehydrogenase domain protein
Query= SwissProt::P28811 (298 letters) >FitnessBrowser__Marino:GFF1553 Length = 290 Score = 147 bits (370), Expect = 4e-40 Identities = 92/274 (33%), Positives = 147/274 (53%), Gaps = 8/274 (2%) Query: 1 MTDIAFLGLGNMGGPMAANLLKAGHRVNVFD-LQPKAVLGLVEQGAQGADSALQCCEGAE 59 MT AF+GLG MG PMA +L KAG V V++ KA E + + GA+ Sbjct: 1 MTTAAFIGLGVMGYPMAGHLAKAGLDVRVWNRTNAKAEQWASEYSGTSCTTIAETVRGAD 60 Query: 60 VVISMLPAGQHVESLYLGDDGLLARVAGKPLLIDCSTIAPETARKVAEAAAAKGLTLLDA 119 +V++ + A + ++Y GD+G+LA + +L+D +T + A +AEAA+ + +DA Sbjct: 61 IVLTCVGADTDLMAVYEGDEGILANASEGAVLVDHTTASAGIAEYLAEAASKNNMGFVDA 120 Query: 120 PVSGGVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFHAGDHGAGQVAKICNNMLLG 179 PVSGG GA G L+ + GG + +A+A PV+E+ R + G G+GQ K+ N + + Sbjct: 121 PVSGGQQGAENGKLTIMCGGSEQDYAKAEPVMEHYARALNRMGPAGSGQKTKMVNQIAIA 180 Query: 180 ILMAGTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNLYNPWPGVMPQAPASNGYAGGF 239 L+ G +EAL + LD A + +V+ + + +W + + G M + + GF Sbjct: 181 GLVQGLSEALHFAEQAELDVAKVVDVISKGAAQSWQMENRS---GTM----IAGEFEHGF 233 Query: 240 QVRLMNKDLGLALANAQAVQASTPLGALARNLFS 273 V M KDLG+ L A+ V AS P+ AL ++ Sbjct: 234 AVDWMRKDLGICLEEARKVNASLPVTALVDQFYA 267 Lambda K H 0.317 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 290 Length adjustment: 26 Effective length of query: 272 Effective length of database: 264 Effective search space: 71808 Effective search space used: 71808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory