Align Probable 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (uncharacterized)
to candidate GFF3544 HP15_3486 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenase
Query= curated2:P63936 (294 letters) >FitnessBrowser__Marino:GFF3544 Length = 303 Score = 148 bits (374), Expect = 1e-40 Identities = 101/287 (35%), Positives = 146/287 (50%), Gaps = 16/287 (5%) Query: 4 IAFLGLGNMGAPMSANLVGAGHVVRGFDPAPTAASGAAAHGVAVFRSAPEAVAEADVVIT 63 IAFLG+G MG PM+ NL+ AG + ++ + A+ V + S EAVA ADVVIT Sbjct: 8 IAFLGIGLMGTPMTRNLLNAGFPMTLWNRTSSKCEPFASEAV-IAESPAEAVANADVVIT 66 Query: 64 MLPTGEVVRRCYT--DVLAAARPATLFIDSSTISVTDAREVHALAESHGMLQLDAPVSGG 121 ML +VV + + A +P L ID S+I + AR L G +DAPVSGG Sbjct: 67 MLENSDVVEQVLVAQGAIDALKPGALVIDMSSIQPSVARRHGELVAEQGAGYVDAPVSGG 126 Query: 122 VKGAAAATLAFMVGGDESTLRRARPVLEPMAGKIIHCGAAGAGQAAKVCNNMVLAVQQIA 181 GAA A L+ M GG E+ + RARPV E + GK G GAGQ AK+ N ++ + A Sbjct: 127 TVGAAEARLSIMAGGSEADVDRARPVFEAL-GKCTRIGPVGAGQLAKLANQAIVGITIGA 185 Query: 182 IAEAFVLAEKLGLSAQSLFDVITG--ATGNCWAVHTNCPVPGPVPTSPANNDFKPGFSTA 239 ++EA +LA K G ++ + + G A +H + + +F PG Sbjct: 186 VSEALLLAAKGGADPAAVREALLGGFAGSRILELHGQRMI---------DREFAPGAPAR 236 Query: 240 LMNKDLGLAMDAVAATGATAPLGSHAADIYAKFAAD-HADLDFSAVI 285 + KD+ + +D A G T PL + Y A+ H+D+D S ++ Sbjct: 237 IQLKDMRMILDEARAEGLTLPLAQQTHNEYLSLVANGHSDVDHSGLL 283 Lambda K H 0.319 0.131 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 303 Length adjustment: 27 Effective length of query: 267 Effective length of database: 276 Effective search space: 73692 Effective search space used: 73692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory