GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mmsB in Marinobacter adhaerens HP15

Align 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (characterized)
to candidate GFF931 HP15_910 3-hydroxyisobutyrate dehydrogenase

Query= SwissProt::P28811
         (298 letters)



>lcl|FitnessBrowser__Marino:GFF931 HP15_910 3-hydroxyisobutyrate
           dehydrogenase
          Length = 295

 Score =  405 bits (1040), Expect = e-118
 Identities = 205/295 (69%), Positives = 235/295 (79%), Gaps = 2/295 (0%)

Query: 1   MTDIAFLGLGNMGGPMAANLLKAGHRVNVFDLQPKAVLGLVEQGAQGADSALQCCEGAEV 60
           M  I F+GLGNMGGPMA NL+KAGH V VFDL   AV  LV +GA+ A +A +   GAE 
Sbjct: 1   MAKITFIGLGNMGGPMAGNLVKAGHEVTVFDLSKDAVAALVSEGAKTAGTAHEAASGAEC 60

Query: 61  VISMLPAGQHVESLYLGDDGLLARVAGKPLLIDCSTIAPETARKVAEAAAAKGLTLLDAP 120
           VI+MLPAGQHVE++YLGDDGLLA++    L+ID STIAPETAR VAE A AK +  LDAP
Sbjct: 61  VITMLPAGQHVEAVYLGDDGLLAKLPAGTLVIDSSTIAPETARGVAEVARAKDIPFLDAP 120

Query: 121 VSGGVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFHAGDHGAGQVAKICNNMLLGI 180
           VSGGVGGA+AGTL+FI GG  E F +A+P+L+ MG+NIFHAGDHG+GQVAKICNNMLL I
Sbjct: 121 VSGGVGGAKAGTLTFICGGSEEAFNKAKPILDTMGKNIFHAGDHGSGQVAKICNNMLLAI 180

Query: 181 LMAGTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNLYNPWPGVMPQAPASNGYAGGFQ 240
           LM+GT+EALALGVKNGLDPAVLSE+MKQSSGGNWALN+YNPWPGVM   PAS  Y GGF 
Sbjct: 181 LMSGTSEALALGVKNGLDPAVLSEIMKQSSGGNWALNVYNPWPGVMEGVPASRNYEGGFL 240

Query: 241 VRLMNKDLGLALANAQAVQASTPLGALARNLFSLHAQADAEHEGLDFSSIQKLYR 295
           V LM KDLGLA  NA   QAS P+G+LARNLF LH  A   +  LDFSSIQ+LY+
Sbjct: 241 VNLMTKDLGLAFDNAVKNQASIPMGSLARNLFQLH--AGQGNGSLDFSSIQRLYK 293


Lambda     K      H
   0.317    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 381
Number of extensions: 9
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 298
Length of database: 295
Length adjustment: 26
Effective length of query: 272
Effective length of database: 269
Effective search space:    73168
Effective search space used:    73168
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

Align candidate GFF931 HP15_910 (3-hydroxyisobutyrate dehydrogenase)
to HMM TIGR01692 (mmsB: 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01692.hmm
# target sequence database:        /tmp/gapView.8428.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01692  [M=288]
Accession:   TIGR01692
Description: HIBADH: 3-hydroxyisobutyrate dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
   1.8e-136  440.1   6.5   2.1e-136  439.9   6.5    1.0  1  lcl|FitnessBrowser__Marino:GFF931  HP15_910 3-hydroxyisobutyrate de


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Marino:GFF931  HP15_910 3-hydroxyisobutyrate dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  439.9   6.5  2.1e-136  2.1e-136       1     288 []       6     293 ..       6     293 .. 1.00

  Alignments for each domain:
  == domain 1  score: 439.9 bits;  conditional E-value: 2.1e-136
                          TIGR01692   1 fiGlGnmGgpmaanllkaghavrvfdlsakaveelveaGaqaaasaaeaveeadvvitmlPagkhvesvyagdegi 76 
                                        fiGlGnmGgpma nl+kagh+v+vfdls +av  lv +Ga++a +a ea+++a++vitmlPag+hve+vy+gd+g+
  lcl|FitnessBrowser__Marino:GFF931   6 FIGLGNMGGPMAGNLVKAGHEVTVFDLSKDAVAALVSEGAKTAGTAHEAASGAECVITMLPAGQHVEAVYLGDDGL 81 
                                        9*************************************************************************** PP

                          TIGR01692  77 lakvkkksllidsstidvdsarkvaeeaaakGavfldaPvsGGvggaraGtltfmvGgeaeefaraepvleamgkn 152
                                        lak+  ++l+idssti++++ar vae a ak   fldaPvsGGvgga+aGtltf+ Gg++e+f++a+p+l++mgkn
  lcl|FitnessBrowser__Marino:GFF931  82 LAKLPAGTLVIDSSTIAPETARGVAEVARAKDIPFLDAPVSGGVGGAKAGTLTFICGGSEEAFNKAKPILDTMGKN 157
                                        **************************************************************************** PP

                          TIGR01692 153 ivhaGdaGaGqaakiCnnlllgismiGvaealalgeklGldpkvlaeilskssGrcWsldtynPvPGvveqaPasn 228
                                        i+haGd+G+Gq+akiCnn+ll+i m G++ealalg+k+Gldp+vl+ei+++ssG +W+l+ ynP+PGv+e++Pas+
  lcl|FitnessBrowser__Marino:GFF931 158 IFHAGDHGSGQVAKICNNMLLAILMSGTSEALALGVKNGLDPAVLSEIMKQSSGGNWALNVYNPWPGVMEGVPASR 233
                                        **************************************************************************** PP

                          TIGR01692 229 gykgGfatalmlkdlglaqeaaksvkasvllGalarelyslfaskgagkkdfsavikllr 288
                                        +y+gGf ++lm+kdlgla ++a + +as+++G+lar+l++l+a +g g +dfs++++l++
  lcl|FitnessBrowser__Marino:GFF931 234 NYEGGFLVNLMTKDLGLAFDNAVKNQASIPMGSLARNLFQLHAGQGNGSLDFSSIQRLYK 293
                                        *********************************************************995 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (288 nodes)
Target sequences:                          1  (295 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01
# Mc/sec: 8.09
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory