GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pccA in Marinobacter adhaerens HP15

Align Propionyl-CoA carboxylase alpha chain, mitochondrial; PCCase subunit alpha; Propanoyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.3 (characterized)
to candidate GFF2598 HP15_2542 methylcrotonoyl-coenzyme A carboxylase 1 (alpha)

Query= SwissProt::P0DTA4
         (730 letters)



>lcl|FitnessBrowser__Marino:GFF2598 HP15_2542
           methylcrotonoyl-coenzyme A carboxylase 1 (alpha)
          Length = 656

 Score =  493 bits (1270), Expect = e-144
 Identities = 280/667 (41%), Positives = 393/667 (58%), Gaps = 28/667 (4%)

Query: 65  KILIANRGEIACRVIKTCKKMGIKTVAVHSDVDASSVHVTMADEAVCVGPAPTSKSYLNM 124
           K+LIANRGEIA RVI+T K +G +TVAV+S+ DA ++HV +ADEAVC+GPA  S SYLN 
Sbjct: 4   KLLIANRGEIAVRVIRTAKALGYRTVAVYSEADAKAMHVELADEAVCIGPAQVSASYLNS 63

Query: 125 DAIMEAVRTTRAQAVHPGYGFLSENKEFAKCLAAEGVIFIGPDTHAIQAMGDKIESKLLA 184
           DAI+EA R T A  +HPGYGFLSEN  FA      G++F+GP   AI+ MG K  SK+  
Sbjct: 64  DAILEAARKTGADCIHPGYGFLSENAAFANACKDAGLVFVGPPASAIELMGSKRRSKIAM 123

Query: 185 KKAKVNTIPGFDGVVKDADEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRF 244
           ++A V  +PG++G   + DE +  A++IGYP+MIKASAGGGG+GMR+   + E  D  + 
Sbjct: 124 QEAGVPVVPGYEGNNANDDELIAAAKDIGYPLMIKASAGGGGRGMRLVESESELADNIKR 183

Query: 245 SSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQRRNQKVVEEAP 304
           +  E+  +FGDD L++EK +  PRH+EIQV  D+HGNA++L ER+CS+QRR+QKVVEEAP
Sbjct: 184 ARSESKQAFGDDELILEKAVIEPRHVEIQVFADRHGNAVYLGERDCSVQRRHQKVVEEAP 243

Query: 305 SIFLDSETRRAMGEQAVALAKAVNYSSAGTVEFLVDSKKNFYFLEMNTRLQVEHPVTECI 364
           S F+  E R+AMGE AV  A A NY  AGTVEFLVD  +NFYFLEMNTRLQVEHPVTE I
Sbjct: 244 SPFVTPELRQAMGEAAVKAALACNYEGAGTVEFLVDKHRNFYFLEMNTRLQVEHPVTELI 303

Query: 365 TGLDLVQEMIRVAKGYPLRHRQADIPINGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPI 424
           TG DLV   + VA+G PL   Q DI +NG A+E R+YAEDP   F  P  G L  + EP 
Sbjct: 304 TGQDLVAWQLNVAEGRPLPLSQDDIHLNGHAIEVRLYAEDPAHGF-TPQTGSLYAF-EPA 361

Query: 425 HLPGVRVDSGIQPGSDISIYYDPMISKLITYGSNRMEALKRMENALDNYVIRGVTHNIAL 484
              G+R D+G++ G  I+ +YDPM++K+I +G NR EA +R+  +L++  + GVT N   
Sbjct: 362 EGEGLRFDTGVRSGDAITPHYDPMLAKVIAWGQNRDEARRRLIRSLEDTTVFGVTTNRHF 421

Query: 485 LREVIINSRFVEGDINTKFLSDVYPD--GFKGHKLTEDERNQLLAIASSLFVASQLRAQR 542
           L  +I +  F  G   T FL   + D    +   LT  +    LA+A+ +          
Sbjct: 422 LSRIIADETFGAGGATTAFLQQAFKDDPSLQPQNLTIRQ----LALAACVLDHGISGQSA 477

Query: 543 FQEPENSRVPIIKPQVANWELSIRLHDEVHTVTASNSGPTFSVEVDGSKLNVTSTWNLAS 602
           +     +  PI           +   D    +  + SG   SV +  ++ ++        
Sbjct: 478 WSNAPATMTPI----------KLETGDTTVELLVTRSGSRLSVSMGETRHSLVLESQRDG 527

Query: 603 PLLSVSIDGTQRTIQCLSRDAGGNMSIQFLGTVYKVHILTKLAAELNKFMLEKAAEDTSS 662
            L  +  +G ++   C     G ++ +Q  G  + V  +T   A         A    S 
Sbjct: 528 HLCIID-NGVRQA--CQYHRQGDSLYLQAFGQSWSVRDVTHQPA-------RTAGGAGSG 577

Query: 663 ILHSPMPGVVVAVSVKPGDLVAEGQEICVIEAMKMQNSMTAGKTGKVKSVHCKAGDTVGE 722
            + + M G ++ V V+ G  V +G  + ++EAMKM++ + A + G+V  +    GD V  
Sbjct: 578 RIQATMDGAIIDVLVEAGQSVHQGDTLVILEAMKMEHPVKADRDGRVAEILASKGDQVKR 637

Query: 723 GDLLVEL 729
             LLV++
Sbjct: 638 SQLLVQI 644


Lambda     K      H
   0.318    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1103
Number of extensions: 45
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 2
Length of query: 730
Length of database: 656
Length adjustment: 39
Effective length of query: 691
Effective length of database: 617
Effective search space:   426347
Effective search space used:   426347
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory