GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pccA1 in Marinobacter adhaerens HP15

Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate GFF2598 HP15_2542 methylcrotonoyl-coenzyme A carboxylase 1 (alpha)

Query= metacyc::MONOMER-13597
         (509 letters)



>lcl|FitnessBrowser__Marino:GFF2598 HP15_2542
           methylcrotonoyl-coenzyme A carboxylase 1 (alpha)
          Length = 656

 Score =  369 bits (946), Expect = e-106
 Identities = 193/443 (43%), Positives = 279/443 (62%), Gaps = 3/443 (0%)

Query: 6   RVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPALDSYLNI 65
           ++L+ANRGEIA RV++  K +G   +AVYSEAD  A+H + ADEA  IG A    SYLN 
Sbjct: 4   KLLIANRGEIAVRVIRTAKALGYRTVAVYSEADAKAMHVELADEAVCIGPAQVSASYLNS 63

Query: 66  EHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKDKLDGKRLA 125
           + I++AA K   D IHPGYGFLSENA FA A + AG+ F+GP +  +  +  K   K   
Sbjct: 64  DAILEAARKTGADCIHPGYGFLSENAAFANACKDAGLVFVGPPASAIELMGSKRRSKIAM 123

Query: 126 NMAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQDQLMDVWER 185
             AGVP  PG +G   + DE +  A+ IGYP+M+KA++GGGG G+  V+++ +L D  +R
Sbjct: 124 QEAGVPVVPGYEGNNANDDELIAAAKDIGYPLMIKASAGGGGRGMRLVESESELADNIKR 183

Query: 186 NKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRNQKLIEEAP 245
            +  + QAFG  +L +EK  + PRH+E Q+  D++GN V   ER+C++QRR+QK++EEAP
Sbjct: 184 ARSESKQAFGDDELILEKAVIEPRHVEIQVFADRHGNAVYLGERDCSVQRRHQKVVEEAP 243

Query: 246 SPALKMEERESMFEPIIKFGKLINYFTLGTFETAFSDVSRDFYFLELNKRLQVEHPTTEL 305
           SP +  E R++M E  +K     NY   GT E    D  R+FYFLE+N RLQVEHP TEL
Sbjct: 244 SPFVTPELRQAMGEAAVKAALACNYEGAGTVE-FLVDKHRNFYFLEMNTRLQVEHPVTEL 302

Query: 306 IFRIDLVKLQIKLAAGEHLPFSQEDLNKRVRGTAIEYRINAEDALNNFTGSSGFVTYYRE 365
           I   DLV  Q+ +A G  LP SQ+D++  + G AIE R+ AED  + FT  +G +  +  
Sbjct: 303 ITGQDLVAWQLNVAEGRPLPLSQDDIH--LNGHAIEVRLYAEDPAHGFTPQTGSLYAFEP 360

Query: 366 PTGPGVRVDSGIESGSYVPPYYDSLVSKLIVYGESREYAIQAGIRALADYKIGGIKTTIE 425
             G G+R D+G+ SG  + P+YD +++K+I +G++R+ A +  IR+L D  + G+ T   
Sbjct: 361 AEGEGLRFDTGVRSGDAITPHYDPMLAKVIAWGQNRDEARRRLIRSLEDTTVFGVTTNRH 420

Query: 426 LYKWIMQDPDFQEGKFSTSYISQ 448
               I+ D  F  G  +T+++ Q
Sbjct: 421 FLSRIIADETFGAGGATTAFLQQ 443


Lambda     K      H
   0.317    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 682
Number of extensions: 26
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 509
Length of database: 656
Length adjustment: 36
Effective length of query: 473
Effective length of database: 620
Effective search space:   293260
Effective search space used:   293260
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory