Align acyl-CoA oxidase (EC 1.3.3.6) (characterized)
to candidate GFF2 HP15_2 acyl-CoA dehydrogenase domain protein
Query= BRENDA::Q96329 (436 letters) >FitnessBrowser__Marino:GFF2 Length = 389 Score = 159 bits (403), Expect = 1e-43 Identities = 113/383 (29%), Positives = 186/383 (48%), Gaps = 6/383 (1%) Query: 46 SDYYHFNDLLTPEEQAIRKKVRECMEKEVAPIMTEYWEKAEFPFHITPKLGAMGVAGGSI 105 S Y N L +R+++ E+AP E EFP + K+G MG+ G ++ Sbjct: 3 SQYSELNFGLGETLDMLREQINGFAASEIAPRAEEIDRNNEFPMDLWRKMGDMGLLGITV 62 Query: 106 -KGYGCPGLSITANAIATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLA 164 + YG + A+ IA EI+R AS HS+L + I G+E QK+KYLP L Sbjct: 63 SEEYGGSDMGYLAHVIAMEEISRASASVGLSYGAHSNLCVNQIHRNGTEEQKQKYLPKLV 122 Query: 165 QLNTVACWALTEPDNGSDASGLGTTATKVEGGWKINGQKRWIGNSTFADLLIIFARNTT- 223 + A++EP+ GSD + TA + +NG K WI N A+ +I+A+ T Sbjct: 123 SGEHIGALAMSEPNAGSDVISMKLTAKDEGDHYLLNGNKMWITNGPDANTYVIYAKTDTS 182 Query: 224 --TNQINGFIVKKDAPGLKATKIPNKIGLRMVQNGDILLQNVFVPDEDRLPGV-NSFQDT 280 + + FIV++DAPG + +K+G+R +++ Q+ VP E+ L GV N + Sbjct: 183 AGSRGVTAFIVERDAPGFSRHQKLDKLGMRGSNTCELVFQDCKVPKENVLGGVGNGAKVL 242 Query: 281 SKVLAVSRVMVAWQPIGISMGIYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLGNVQAM 340 L R++++ P+GI D+ Y++ERKQFG + F+L Q K+ M + Sbjct: 243 MSGLDYERLVLSGGPLGIMQAAMDVVVPYIRERKQFGQAIGEFELVQGKVADMYTWMNTA 302 Query: 341 FLMGWRLCKLYETGQMTPGQASLGKAWISSK-ARETASLGRELLGGNGILADFLVAKAFC 399 + + + G T + + G S++ A + A +LLGGNG + ++ + Sbjct: 303 KSYVYMVAMSADRGAETTRKDAAGAILYSAEMATKIALDAIQLLGGNGYINEYPTGRLLR 362 Query: 400 DLEPIYTYEGTYDINTLVTGREV 422 D + GT +I ++ GRE+ Sbjct: 363 DAKLYEIGAGTSEIRRMLIGREL 385 Lambda K H 0.319 0.133 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 389 Length adjustment: 31 Effective length of query: 405 Effective length of database: 358 Effective search space: 144990 Effective search space used: 144990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory