Align ABC transporter for Xylitol, permease component 1 (characterized)
to candidate GFF2208 HP15_2162 sugar ABC transporter, permease protein
Query= reanno::Dino:3607126 (288 letters) >FitnessBrowser__Marino:GFF2208 Length = 288 Score = 153 bits (386), Expect = 5e-42 Identities = 84/235 (35%), Positives = 135/235 (57%), Gaps = 8/235 (3%) Query: 50 FIGLENYWTVLTDEVFWQAMGRTFFLLGTALPLQIALGLGIALVLHQPGLTLVKTLARLS 109 F+G E + VLTDE ++ R F G L +QI LG+G+AL++ + G+ +L + Sbjct: 47 FVGTEWFKEVLTDERLQDSLIRQFIFSGAVLLIQIPLGIGVALMMPKSGIK--GSLCLIL 104 Query: 110 LVLPMATTYAVVGLLGQVMFNQKFGV----VNQLLGGADINWIGDPENAFAMIIFWDVWQ 165 L +P+ + VVG + Q+ G+ +NQL G D N+ GD +A+ ++ DVW Sbjct: 105 LAIPLLIPWNVVGTIWQIFARGDIGLFGWGINQL--GIDYNYTGDTLDAWLTVLLMDVWH 162 Query: 166 WTPFVALVLLAGLTMVPGEVEEAARLETKSKWTVLRYVQLPFLLPGLVAVLILRTADTLK 225 WTP VAL+ +GL +P +AA ++ SKW V RY+QLP L L+ ++LR D+ Sbjct: 163 WTPLVALLCYSGLRAIPEAFYQAAEIDRASKWAVFRYIQLPRLKSVLIIAVLLRFMDSFM 222 Query: 226 LFDMVFTLTRGGPGSSTEFISLMIQRVGFRGFDQGLASAQAIILLIITIVLAQIY 280 ++ F LT GGPGSST F+S + + FD G A+A ++I +I ++++ ++ Sbjct: 223 IYIEPFVLTGGGPGSSTTFLSQTLTTMAIGQFDLGRAAAFSLIYFLIVLLISWLF 277 Lambda K H 0.329 0.144 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 288 Length adjustment: 26 Effective length of query: 262 Effective length of database: 262 Effective search space: 68644 Effective search space used: 68644 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory