Align ABC transporter for D-Glucose-6-Phosphate, permease component 1 (characterized)
to candidate GFF3012 HP15_2956 sugar ABC transporter, permease protein
Query= reanno::WCS417:GFF4322 (281 letters) >FitnessBrowser__Marino:GFF3012 Length = 289 Score = 435 bits (1119), Expect = e-127 Identities = 211/278 (75%), Positives = 243/278 (87%), Gaps = 9/278 (3%) Query: 13 SRIAIYAVLILAVLLYLVPLVVMLLTSFKTPEDISSGNLLSWPTVVTGIGWVKAWAT--- 69 SR+AIY +L+LA L+YL+PL +ML+TSFKTP DI +GNL++ PT T IGW KAW+ Sbjct: 12 SRVAIYGLLLLAALVYLIPLFIMLVTSFKTPMDIRTGNLMALPTDWTTIGWTKAWSEACT 71 Query: 70 ------VDGYFWNSIKITVPAVLISTAIGALNGYVLSFWRFKGSQLFFGLLLFGCFLPFQ 123 + GYFWNS K+TVPAVLIST +GA NGYVLS W+FKGS LFFG+LLFGCF+PFQ Sbjct: 72 GVQCEGISGYFWNSFKMTVPAVLISTLLGAFNGYVLSKWKFKGSDLFFGMLLFGCFVPFQ 131 Query: 124 TVLLPASFTLGKMGLASTTTGLVFVHVVYGLAFTTLFFRNYYVSIPDALIKAARLDGAGF 183 VLLP + TLGK+GLA+TT+GLV VHV+YG+AFTTLFFRNYYV+IPDALIKAARLDGAGF Sbjct: 132 VVLLPMAATLGKLGLANTTSGLVLVHVIYGVAFTTLFFRNYYVAIPDALIKAARLDGAGF 191 Query: 184 FTIFRQIILPMSTPIIMVCLIWQFTQIWNDFLFGVVFSSGDSQPITVALNNLVNTSTGAK 243 FTIF +I+LPMSTPI MV LIWQFTQIWNDFLFGVVF+SGDSQPITVALNNLVNTSTG K Sbjct: 192 FTIFFRILLPMSTPIFMVSLIWQFTQIWNDFLFGVVFASGDSQPITVALNNLVNTSTGVK 251 Query: 244 EYNVDMAAAMIAGLPTLLVYVIAGKYFVRGLTAGAVKG 281 EYNVDMAAAMIA LPTL+VY++AGKYF+RGLTAG+VKG Sbjct: 252 EYNVDMAAAMIAALPTLVVYIVAGKYFIRGLTAGSVKG 289 Lambda K H 0.328 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 328 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 289 Length adjustment: 26 Effective length of query: 255 Effective length of database: 263 Effective search space: 67065 Effective search space used: 67065 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory