GapMind for catabolism of small carbon sources

 

Alignments for a candidate for fcbT2 in Desulfovibrio vulgaris Miyazaki F

Align FcbT2, component of Tripartite 4-chlorobenzoate symporter (also binds and may transport 4-bromo-, 4-iodo-, and 4-fluorobenzoate and with a lower affinity, 3-chlorobenzoate, 2-chlorobenzoate, 4-hydroxybenzoate, 3-hydroxybenzoate, and benzoate) (characterized)
to candidate 8501197 DvMF_1931 TRAP dicarboxylate transporter, DctM subunit (RefSeq)

Query= TCDB::Q9RBR0
         (181 letters)



>FitnessBrowser__Miya:8501197
          Length = 640

 Score = 42.4 bits (98), Expect = 2e-08
 Identities = 30/100 (30%), Positives = 50/100 (50%), Gaps = 5/100 (5%)

Query: 60  VAEYSLYAITFLAAPLLLRKGQHIRVDLVLRAMPPRAAWLLEWAVDACGAAISG-LFLTS 118
           ++ Y    I++LA PL + K  +IRVD++   +PPRA  +    VD C   ++G L    
Sbjct: 84  LSRYLFIWISYLAVPLAIMKRSNIRVDVLCAKLPPRAQGMAWVVVDVCTLVLTGALCYMG 143

Query: 119 SVHVLVQ-SYSQSAMVMREMMFPEWWLYIPMPISLALLTI 157
             HV +Q +  Q+   M    F     Y+ +P+   L+T+
Sbjct: 144 FGHVQMQIAMPQTTPAMGIKYFIP---YMILPVGFFLMTL 180


Lambda     K      H
   0.327    0.134    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 278
Number of extensions: 20
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 181
Length of database: 640
Length adjustment: 28
Effective length of query: 153
Effective length of database: 612
Effective search space:    93636
Effective search space used:    93636
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory