Align FcbT3, component of Tripartite 4-chlorobenzoate symporter (also binds and may transport 4-bromo-, 4-iodo-, and 4-fluorobenzoate and with a lower affinity, 3-chlorobenzoate, 2-chlorobenzoate, 4-hydroxybenzoate, 3-hydroxybenzoate, and benzoate) (characterized)
to candidate 8501197 DvMF_1931 TRAP dicarboxylate transporter, DctM subunit (RefSeq)
Query= TCDB::Q9RBQ9 (439 letters) >FitnessBrowser__Miya:8501197 Length = 640 Score = 203 bits (517), Expect = 1e-56 Identities = 125/432 (28%), Positives = 232/432 (53%), Gaps = 17/432 (3%) Query: 6 AAWLLLGGTTVLLFLGLPVAYSFFAINVVGAWLFLGGDSALGQLVRNGLVAVASFSLTPI 65 A WLL G + L +G+P+A+S + A + G L L + V++ SF + I Sbjct: 220 AVWLLFGYFVLFLLVGVPIAFSLGLATI--ATVLGAGTLPLEYLAQIAFVSIDSFPILAI 277 Query: 66 PLFILMGELLFHTGLAQRAIDGIDKVIPRLPGRLAVIAVVAGTFFSAISGSTIATTAMLG 125 P FI G + GL++R + D+++ LPG +A+ +V FF+AISGS AT A +G Sbjct: 278 PFFIAAGVFMGAGGLSRRLLALGDELVGALPGGMALATIVTCMFFAAISGSGPATVAAIG 337 Query: 126 SLMLPMMLARGYEPKLGMGPIIAIGGVDMLIPPSALAVLLGSLAGISISKLLIGGVLPGL 185 S+ +P M+ RGY+ + + G + ++IPPS V+ G A S+ KL + G++PG+ Sbjct: 338 SITIPAMVERGYDKFFAAAVVASAGCIGVMIPPSNPFVVYGVAAQASVGKLFLAGIVPGV 397 Query: 186 L--LAISFVAYIVASAK-LRPESAPREELVVLRG-WERWRELVVYVLPLSLIFVAIVAVI 241 L LA+ VAY ++ K R E+ R+ V++ WE L+V V+ L I+ Sbjct: 398 LCGLALMAVAYYISLKKGWRGEARHRDFRSVMQAMWEAKWALLVPVIVLGGIY------- 450 Query: 242 SGGVATPTEAAAIGCAATLAITL-MYRALRWQSLVQALQGTVAISGMILFIIVAATTFSQ 300 GG+ TPTEAAA+ + + L +YR + W+ + + + S +I+ ++ AT F Sbjct: 451 -GGIMTPTEAAAVSALYGMIVGLFIYREITWRRMWDCMVESAQTSSVIIVLMAMATLFGN 509 Query: 301 VLSFSGATNGIVDLVQSSGLPPAGVVAIMLAILIFLGLFVDQVSMMLLTLPFYMPIVKSL 360 +++ + I ++ ++ ++ L+++G F++ ++ +++ P +P+V + Sbjct: 510 IMTIEQVPDHIAAMILGVTSNKIAILLLINVFLLWVGTFMEALAAIVIITPILLPLVTQV 569 Query: 361 GIDQIWFGVMYLICMQLGLLMPPHGMLLYTMKGVAPKHITMGQVFASAMPYVGLSFTMLI 420 G+D I FGV+ ++ + +G + PP G+ L+ ++ +++G V +A P++ + +L+ Sbjct: 570 GVDPIHFGVIMVVNLAIGFITPPVGVNLFVASSIS--KVSIGDVVRAAWPFLLVMIALLM 627 Query: 421 LIFFWPGIATWL 432 I + P I+ L Sbjct: 628 AITYIPAISLCL 639 Lambda K H 0.329 0.143 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 668 Number of extensions: 40 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 640 Length adjustment: 35 Effective length of query: 404 Effective length of database: 605 Effective search space: 244420 Effective search space used: 244420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory