Align Benzoate--CoA ligase; Benzoyl-CoA synthetase; EC 6.2.1.25 (characterized)
to candidate 8499218 DvMF_0003 AMP-dependent synthetase and ligase (RefSeq)
Query= SwissProt::Q8GQN9 (527 letters) >FitnessBrowser__Miya:8499218 Length = 557 Score = 214 bits (544), Expect = 9e-60 Identities = 170/535 (31%), Positives = 255/535 (47%), Gaps = 34/535 (6%) Query: 16 IKIPERYNAADDLIGRNLLAGRGGKTV-YIDDAG---SYTYDELALRVNRCGSALRTTLG 71 I P+ +N A D++ A G + ++DDAG YT+ +A + +ALR G Sbjct: 21 IDAPDTFNFAFDVLDPIAAADPGRLCIAHVDDAGVRRDYTFAWMAEASAKLANALRLR-G 79 Query: 72 LQPKDRVLVCVLDGIDFPTTFLGAIKGGVVPIAINTLLTESDYEYMLTDSAARVAVVSQE 131 ++ DRV++ + I+F + L + G V I LT D + + + R +V Sbjct: 80 IRKGDRVMLVLYRRIEFWVSMLALHRLGAVAIPAPAQLTPKDIVFRVERAKTRCVIVDHS 139 Query: 132 LLPLFAPMLGKVPTLEHLVVAGGAGEDSLAA------LLATGSEQFEAAPTRP------D 179 + P L V GG D+L + T +E P P + Sbjct: 140 ITERVEAARPDCPGLAVCVQVGG---DALPRGWVDYDTIFTPAEARFPRPESPLEFAGGE 196 Query: 180 DHCFWLYSSGSTGAPKGTVHIHS-DLIHTAE-LYARPILGIREGDVVFSAAKLFFAYGLG 237 D +SSG+TG PK H+H+ L H +Y ++ GD+ + A + + Sbjct: 197 DPLLIFFSSGTTGMPKMVEHVHTYPLGHLLTGMYWHDLV---PGDLHLTLADTGWGKAVW 253 Query: 238 NGLIFPLAVGATAVLMAERPT--PAAVFERLRRHQPDIFYGVPTLYASMLANPDCPKEGE 295 GA+ + R PAA+ + L H F PT+Y L D Sbjct: 254 GKFYGQWMAGASVFVYDFRGKFEPAALLDVLAAHAVTTFCAPPTVYR-FLVRQDLSAYDL 312 Query: 296 LRLRACTSAGEALPEDVGRRWQARFGVDILDGIGSTEMLHIFLSNRAGDVHYGTSGKPVP 355 +LR CT+AGE L + V W+A G++I +G G TE + G+ G+P+P Sbjct: 313 SKLRHCTTAGELLNDSVFHDWKAATGLEIHEGYGQTETTLQIATLPCMTPKAGSIGRPMP 372 Query: 356 GYRLRLIDEDGAEITTAGVAGELQISGPSSAVM-----YWNNPEKTAATFMGEWTRSGDK 410 G+ + L D G I G GE+ + + Y PEKTA+ G + +GDK Sbjct: 373 GWDVVLQDAAG-NICPPGEEGEICVRVAEGLPVGLFRGYLEEPEKTASVMFGGYYHTGDK 431 Query: 411 YLVNDEGYYVYAGRSDDMLKVSGIYVSPIEVESALIAHEAVLEAAVVGWEDEDHLIKPKA 470 ++++GYY + GR DD++K SG + P EVESAL+AH AV+EAAV G D KA Sbjct: 432 AWMDEDGYYWFLGRVDDLIKSSGYRIGPFEVESALVAHPAVVEAAVTGVPDPLRGQAVKA 491 Query: 471 FIVLKPGYGAGEALRTDLKAHVKNLLAPYKYPRWIEFVDDLPKTATGKIQRFKLR 525 +VL GY A +AL +L+ HVK + APYKYPR I++V +LPKT +GKI+R ++R Sbjct: 492 TVVLAAGYTASDALTKELQDHVKKVTAPYKYPRIIDYVAELPKTISGKIKRAEIR 546 Lambda K H 0.319 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 803 Number of extensions: 45 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 527 Length of database: 557 Length adjustment: 35 Effective length of query: 492 Effective length of database: 522 Effective search space: 256824 Effective search space used: 256824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory