Align 4-hydroxybenzoyl-CoA reductase, γ subunit (EC 1.3.7.9) (characterized)
to candidate 8499876 DvMF_0641 aldehyde oxidase and xanthine dehydrogenase molybdopterin binding (RefSeq)
Query= metacyc::MONOMER-14378 (158 letters) >FitnessBrowser__Miya:8499876 Length = 905 Score = 122 bits (307), Expect = 1e-32 Identities = 67/146 (45%), Positives = 88/146 (60%), Gaps = 3/146 (2%) Query: 9 VNGRPREDAVAGNALLIDYLRDTLGLTGTKQGCDGGECGACTVLVDGQPRLACCTLAHSV 68 VNG PR V A L D LR+ L LTG K GC G+CGAC+V++DG+ +C + Sbjct: 8 VNGIPRNLVVDPEATLADVLREQLLLTGVKVGCGEGQCGACSVILDGKVVRSCAYKMRRL 67 Query: 69 A-GHSIETIEGLSHEGNLSRLQRAFHEHLGSQCGFCTPGMIMAAEALLRRNPQPSRDEIR 127 G S+ TIEG+ L LQ A+ H G+QCGFCTPG I++A LL N PSRD++R Sbjct: 68 PDGASVTTIEGVGSPDCLHPLQLAWTAHGGAQCGFCTPGFIVSARQLLEENKSPSRDDVR 127 Query: 128 AALA--GNLCRCTGYVKIIESVEAAA 151 N+CRCTGY ++++V AA Sbjct: 128 DWFQKHRNVCRCTGYKPLVDAVMDAA 153 Lambda K H 0.320 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 158 Length of database: 905 Length adjustment: 30 Effective length of query: 128 Effective length of database: 875 Effective search space: 112000 Effective search space used: 112000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory