Align L-proline and D-alanine ABC transporter, permease component 1 (characterized)
to candidate 8501893 DvMF_2608 inner-membrane translocator (RefSeq)
Query= reanno::azobra:AZOBR_RS08235 (301 letters) >FitnessBrowser__Miya:8501893 Length = 302 Score = 298 bits (762), Expect = 1e-85 Identities = 154/300 (51%), Positives = 216/300 (72%), Gaps = 1/300 (0%) Query: 2 EYFLQQLINGLSLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFVALITFLAIGSLG 61 +YF + GL+ G+IY LIA+GYTMVYGII +INFAHGE+YM+GAF ALI A+G G Sbjct: 4 QYFWELFFGGLTRGSIYALIALGYTMVYGIIELINFAHGEVYMMGAFTALIVAGALGIYG 63 Query: 62 ITWVPLALLVMLVASMLFTAVYGWTVERIAYRPLRSSPRLAPLISAIGMSIFLQNYVQIL 121 + + L++ V ++++ A YG T+E+IAY+PLR +PRL+PLISAIGMSIFLQNYV + Sbjct: 64 FPALAI-LIIAAVVAVIYCAAYGLTLEKIAYKPLRDAPRLSPLISAIGMSIFLQNYVILA 122 Query: 122 QGARSKPLQPILPGNLTLMDGAVSVSYVRLATIVITIALMYGFTQLITRTSLGRAQRACE 181 Q + P ++P L A + + IV + M T I T +G+A RA Sbjct: 123 QTSDFMPFPNLVPQPDFLEPIAHIMGASEVLIIVTSAISMAALTLFIKYTRMGKAMRATA 182 Query: 182 QDKKMAGLLGVNVDRVISLTFVMGAALAAVAGMMVLLIYGVIDFYIGFLAGVKAFTAAVL 241 Q++KMA LLG++ D+VISLTFV+G++LAAV G+++ G ++F IGF+AG+KAFTAAVL Sbjct: 183 QNRKMAMLLGIDADKVISLTFVIGSSLAAVGGVLIASHVGQVNFAIGFIAGIKAFTAAVL 242 Query: 242 GGIGSLPGAMLGGVVIGLIEAFWSGYMGSEWKDVATFTILVLVLIFRPTGLLGRPEIEKV 301 GGIGS+PGAMLGG+V+G E+F +GY+ S+++D F +LVL+LIFRP+G+LG+ + +KV Sbjct: 243 GGIGSIPGAMLGGLVLGWCESFATGYISSDYEDALAFALLVLILIFRPSGILGKAKTQKV 302 Lambda K H 0.329 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 302 Length adjustment: 27 Effective length of query: 274 Effective length of database: 275 Effective search space: 75350 Effective search space used: 75350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory