Align D-lactate dehydrogenase (EC 1.1.1.28); D-lactate dehydrogenase (acceptor) (EC 1.1.99.6) (characterized)
to candidate 8500826 DvMF_1567 D-lactate dehydrogenase (cytochrome) (RefSeq)
Query= BRENDA::Q9YEU4 (473 letters) >FitnessBrowser__Miya:8500826 Length = 474 Score = 254 bits (649), Expect = 4e-72 Identities = 161/447 (36%), Positives = 235/447 (52%), Gaps = 25/447 (5%) Query: 27 YSREPSGLEGRAEAVVFPESAQDVSRLVRYAYSREVYIYPQGSSTDLAGGAFPERPGVVV 86 Y R+ S L A+ VV PE+ + V L+R A + + + P+G T LAGG R GVV+ Sbjct: 46 YDRDASELRAPADLVVLPETVEQVQALLRCASAHAIPVIPRGGGTGLAGGCLAVRGGVVL 105 Query: 87 SMERMRRVREVSVLDSVAVVEPGV---RLWDLNVELSKYRYMFPIDPGSVKVATVGGAIN 143 S+ERM R+R + + VA VE GV R+ D E Y +P DP + +T+GG + Sbjct: 106 SLERMNRIRAIDTRNLVAEVEAGVISQRVRDAAAEQGLY---YPPDPAGMDRSTIGGNVA 162 Query: 144 TGAGGMRGARYGTMRDWVLGLEIVLPDEEGTILRVGCRTLKCRQGYDLARLIVGSEGTLA 203 T AGG +YG RD+VLG+E VLPD G +LR G RT K GYD+A L+ GSEGTL Sbjct: 163 TNAGGPACVKYGVTRDYVLGVEAVLPD--GELLRAGVRTRKGVVGYDMAHLLCGSEGTLG 220 Query: 204 IVTEAILKITPMPENVVVVLAFFPTLRQLVDAVIEVKSRAIDTLLMEFMDVDSARLAAET 263 ++T LK+ P+P V + FP + + V V +EF+D RL E Sbjct: 221 VITALTLKLVPLPPATVSMAVAFPDMAAAMRGVAAVLGGGHLPSAIEFLDHRCIRLLGEL 280 Query: 264 LGAAIRPD-GHMLLVGVPVNREASTRVLEEMVSIAKAAGAASVYTAKSMEEAEEKKLLEI 322 L + D +L++ + RE L+ + +I + GA V A +E ++ Sbjct: 281 LPIPVPGDKPSLLIIELDGAREQIVPELDLVAAICRQQGATHVLPA--ADEETRVRVWGA 338 Query: 323 RRSLFATQALLTQKQFKGRKVMMLMEDIAVPPSKLLDAVERLKELEAKYGFKTVLGGHIG 382 RR + + + + ED+AVP + + V L E E +YG + GH G Sbjct: 339 RRQV--------SLRIHDYAALYMSEDVAVPLGAIAELVAALPEFEQRYGMEIFAFGHAG 390 Query: 383 DGNLHPTISYPVDDEKAKEAALKWYYDVMRMAIELGGTVSAEHGIGVLKKEALRLELERM 442 DGN+H ++ P D ++ + +++ +ELGGT+S EHGIG KK L LEL Sbjct: 391 DGNIHLNVTAPTRD--TRDVVEQGIVELVGKVLELGGTISGEHGIGEAKKHLLPLEL--- 445 Query: 443 GSVKALEIMAGIKRVFDPKGILNPGKV 469 S ++ + GI++VFDP+GI+NPGKV Sbjct: 446 -SPASIRLQRGIRQVFDPRGIMNPGKV 471 Lambda K H 0.319 0.136 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 553 Number of extensions: 32 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 473 Length of database: 474 Length adjustment: 33 Effective length of query: 440 Effective length of database: 441 Effective search space: 194040 Effective search space used: 194040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory