Align D-lactate transporter, ATP-binding component (characterized)
to candidate 8501895 DvMF_2610 ABC transporter related (RefSeq)
Query= reanno::Phaeo:GFF1248 (251 letters) >FitnessBrowser__Miya:8501895 Length = 270 Score = 176 bits (445), Expect = 6e-49 Identities = 98/258 (37%), Positives = 158/258 (61%), Gaps = 10/258 (3%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 +L+V+++ FGGL+AL++V+L VR+ + A+IGPNGAGK+T NC+ G +P G+V Sbjct: 12 VLDVRSISMNFGGLRALNEVDLQVRQGEIVALIGPNGAGKTTFFNCITGIYVPTEGTVHV 71 Query: 63 ---DGKSVL--GRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRD----GAFEM 113 DG++V G ++ +G+SR FQ +F +SVLEN+MI + GA Sbjct: 72 TPRDGRTVTVNGLKASQVTALGMSRTFQNIRLFPTMSVLENVMIGRHCRTRAGILGALLR 131 Query: 114 NAISAVSGQRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLD 173 + + QR I+E++ +L+ +N+ A ++ G +RRLEI L+ EP LL LD Sbjct: 132 DPKTRAEEQR-IVEESYALLKSVNLHQHYKDEARNLPYGAQRRLEIARALATEPFLLCLD 190 Query: 174 EPTAGMARADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDP 233 EP AGM +T+ +L+ +I+ ++++ +IEHDM +V SL+DRI V+ G+ + E P Sbjct: 191 EPAAGMNPQETHELKELVIEIRERHELSVLLIEHDMSMVMSLSDRIYVMEYGSKIAEGTP 250 Query: 234 QNIKGNPKVREAYLGESA 251 + + NP+V +AYLGE + Sbjct: 251 EEVSKNPRVIKAYLGEES 268 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 270 Length adjustment: 24 Effective length of query: 227 Effective length of database: 246 Effective search space: 55842 Effective search space used: 55842 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory