Align D-lactate oxidase and glycolate oxidase, FAD-linked subunit (EC 1.1.3.15) (characterized)
to candidate 8501126 DvMF_1862 FAD linked oxidase domain protein (RefSeq)
Query= reanno::psRCH2:GFF3772 (499 letters) >FitnessBrowser__Miya:8501126 Length = 461 Score = 343 bits (879), Expect = 1e-98 Identities = 177/456 (38%), Positives = 266/456 (58%), Gaps = 2/456 (0%) Query: 19 AALLAELQAQLPDLDILHRSEDLKPYECDGLSAYRTTPLLVVLPERIEQVETLLKLCHQR 78 AAL+ E +A + ++ D + Y D P LVV P EQ+ +++LC++ Sbjct: 4 AALIKEFEAVVGKDNVFTSEADRQSYSYDSAVLEAVVPALVVRPTTTEQLGKVVRLCNEN 63 Query: 79 GVPVVARGAGTGLSGGALP-LEQGILLVMARFNKILEVDPAGRFARVQPGVRNLAISQAA 137 G P+ RGAGT LSGG +P +GI+++ N+I+E++ +A V+PGV + Sbjct: 64 GNPITVRGAGTNLSGGTIPDPREGIVILTNSLNRIIEINEEDLYAVVEPGVVTAKFAAEV 123 Query: 138 APYELYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNLLKVDILTVEGERMTLGSD 197 A L+Y PDP SQ ++GGNVAENAGG+ LKYG+T ++ ++ V G + GS Sbjct: 124 AKRGLFYPPDPGSQAVSTLGGNVAENAGGLRGLKYGVTKDYVMGIEFFDVNGGLVKTGSR 183 Query: 198 ALDS-PGFDLLALFTGSEGMLGIVTEVTVKLLPKPQVAKVLLAAFDSVEKAGRAVGDIIA 256 + G++L L SEG LG+ + + +KL+P PQ +K ++A FD V KA AV IIA Sbjct: 184 TVKCVTGYNLAGLMVASEGTLGVFSNIVLKLVPPPQASKAMMAVFDDVNKASEAVAGIIA 243 Query: 257 AGIIPGGLEMMDNLSIRAAEDFIHAGYPVDAEAILLCELDGVEADVHDDCARVSEVLKLA 316 A ++P LE MD +IR +DF AG P DA+AILL E+DG V +D +V +VL Sbjct: 244 AHVVPCTLEFMDQATIRYVDDFTKAGLPRDAQAILLIEVDGHAGQVAEDAEKVEKVLNKV 303 Query: 317 GATEVRLAKDEAERVRFWAGRKNAFPAVGRISPDYYCMDGTIPRRELPGVLKGISDLSEQ 376 GATE+++AKD AE+ + W R+NA PA+ R P D T+PR ++P ++K I+D++ + Sbjct: 304 GATEIKVAKDAAEKFKLWEARRNALPALARAKPTTVLEDATVPRSKIPAMVKAINDIAAK 363 Query: 377 FGLRVANVFHAGDGNMHPLILFDANQPGELERAEDLGGKILELCVKVGGSITGEHGVGRE 436 + + + HAGDGN+HP IL D E ER E +I ++ + + G+++GEHG+G Sbjct: 364 YNISIGTFGHAGDGNLHPTILCDRRDKHEFERVEHAVDEIFDVALSLHGTLSGEHGIGMA 423 Query: 437 KINQMCSQFNADELTLFHAVKAAFDPSGLLNPGKNI 472 K M + + + +K A DP +LNPGK I Sbjct: 424 KSKWMEKETSKATIEFSRNMKRAIDPKYILNPGKII 459 Lambda K H 0.320 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 525 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 499 Length of database: 461 Length adjustment: 34 Effective length of query: 465 Effective length of database: 427 Effective search space: 198555 Effective search space used: 198555 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory