Align D-lactate oxidase, FAD binding subunit (EC 1.1.3.15) (characterized)
to candidate 8500826 DvMF_1567 D-lactate dehydrogenase (cytochrome) (RefSeq)
Query= reanno::Cup4G11:RR42_RS17310 (374 letters) >FitnessBrowser__Miya:8500826 Length = 474 Score = 79.3 bits (194), Expect = 2e-19 Identities = 60/194 (30%), Positives = 90/194 (46%), Gaps = 9/194 (4%) Query: 11 TLTAFRDAIRHATGTRTPLRLRGGGSKDFYG--QHPQGTLLDTRAYSGIVDYDPPELVIT 68 T+ + +R A+ P+ RGGG+ G G +L + I D LV Sbjct: 65 TVEQVQALLRCASAHAIPVIPRGGGTGLAGGCLAVRGGVVLSLERMNRIRAIDTRNLVAE 124 Query: 69 ARCGTPLAQIEAALAERRQMLAFEPPHFSTGADGSDVATIGGAVAAGLSGPRRQAVGALR 128 G ++ A AE+ +P G D +TIGG VA GP G R Sbjct: 125 VEAGVISQRVRDAAAEQGLYYPPDPA-------GMDRSTIGGNVATNAGGPACVKYGVTR 177 Query: 129 DFVLGTRVMDGRGDVLSFGGQVMKNVAGYDVSRLMSGSLGTLGLILEVSLKVLPVPFDDA 188 D+VLG + G++L G + K V GYD++ L+ GS GTLG+I ++LK++P+P Sbjct: 178 DYVLGVEAVLPDGELLRAGVRTRKGVVGYDMAHLLCGSEGTLGVITALTLKLVPLPPATV 237 Query: 189 TLRFALDEAAALDR 202 ++ A + AA R Sbjct: 238 SMAVAFPDMAAAMR 251 Lambda K H 0.321 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 26 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 374 Length of database: 474 Length adjustment: 32 Effective length of query: 342 Effective length of database: 442 Effective search space: 151164 Effective search space used: 151164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory