Align Uncharacterized protein (characterized, see rationale)
to candidate 8499631 DvMF_0397 protein of unknown function DUF224 cysteine-rich region domain protein (RefSeq)
Query= uniprot:B2TBW0 (256 letters) >FitnessBrowser__Miya:8499631 Length = 253 Score = 144 bits (364), Expect = 1e-39 Identities = 86/250 (34%), Positives = 129/250 (51%), Gaps = 16/250 (6%) Query: 7 KELMKVALFIPCFIDAFYPEVGIATLELLERFGIQVDYPQEQTCCGQPMANSGAHAEAAG 66 +++ V F C +D +P+ G+A + LL R G++V +PQEQ+CCGQP NSG EA Sbjct: 9 RDVKTVYYFGTCLVDMSFPQAGMAGIHLLRRAGVEVVFPQEQSCCGQPAYNSGFLEEAKA 68 Query: 67 TERVFARNFAGYDY-IVGPSASCIHHVREHLTALEQTD----EVKKVRANAYELVEFLHD 121 R + F+ D+ IV PS SC +R H + D +V+K +EL +FLH+ Sbjct: 69 VARAQIKAFSRADWPIVVPSGSCAGMMRHHYPEMFANDPEYFDVRKFSERVFELGDFLHN 128 Query: 122 VVGAREFPWAEFPHRVGLHNSCSALRHLKEASISEVAGAPFSKPRTLLEGVKGIEFVKPA 181 + R + P +V H+SC A+R + + + + L+ + +E V+ Sbjct: 129 ALHVRYEDKGK-PVKVTWHSSCHAMREMGATAAA----------KALIGQLSNVELVEIE 177 Query: 182 RPDECCGFGGTFSVTEEPVSVRMGQDKVRDHLNAGAEYIVSGDMSCLMHQQGCAERMKAD 241 R ECCGFGGTFS+ + +S M DKV D GA I+SGD CLM+ G E Sbjct: 178 REYECCGFGGTFSIKQPEISAAMVADKVEDIRATGASAILSGDCGCLMNIGGAMEHKGVP 237 Query: 242 ARFIHIAQVL 251 H+A+ + Sbjct: 238 VAPRHLAEFI 247 Lambda K H 0.323 0.137 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 253 Length adjustment: 24 Effective length of query: 232 Effective length of database: 229 Effective search space: 53128 Effective search space used: 53128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory