Align Uncharacterized protein (characterized, see rationale)
to candidate 8501132 DvMF_1868 protein of unknown function DUF162 (RefSeq)
Query= uniprot:B2TBW0 (256 letters) >FitnessBrowser__Miya:8501132 Length = 716 Score = 113 bits (283), Expect = 1e-29 Identities = 80/250 (32%), Positives = 125/250 (50%), Gaps = 20/250 (8%) Query: 10 MKVALFIPCFIDAFYPEVGIATLELLERFGIQVDYPQEQTCCGQP---MANSGAHAEAAG 66 ++VALF C D YPE A +++L G+++D+P +Q+CCG P MA A + A Sbjct: 474 LRVALFSGCVQDFVYPEQMKAAVKVLASRGVEMDFPMDQSCCGLPVQMMAERQATIDVA- 532 Query: 67 TERVFARNFAGYDYIVGPSASCIHHVREHLTAL--EQTDEVKKVRANAYELVE---FLHD 121 + V A + A YDYI+ ASC H++E + QTD KV+ A ++++ F+HD Sbjct: 533 RQNVMAFDAAKYDYILTLCASCASHLKEGYPNILAGQTDMTGKVKLFASKVIDFSSFVHD 592 Query: 122 VVGAREFPWAEFPHRVGLHNSCSALRHLKEASISEVAGAPFSKPRTLLEGVKGIEFVKPA 181 V+G + +V H+SC R L +PR L+ G E+ Sbjct: 593 VLGMTADDFKGKGEKVAYHSSCHLCRGL----------GVVEQPRALIAS-SGSEYCPAQ 641 Query: 182 RPDECCGFGGTFSVTEEPVSVRMGQDKVRDHLNAGAEYIVSGDMSCLMHQQGCAERMKAD 241 CCGFGGTFS+ +S + K+ + GA +V+ C+M +G AE+ + Sbjct: 642 EEAVCCGFGGTFSMKFPELSKELLDKKLNNAEATGATRMVADCPGCIMQIRGGAEKRGSR 701 Query: 242 ARFIHIAQVL 251 + HIA++L Sbjct: 702 MKVGHIAELL 711 Lambda K H 0.323 0.137 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 438 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 716 Length adjustment: 32 Effective length of query: 224 Effective length of database: 684 Effective search space: 153216 Effective search space used: 153216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory