Align Uncharacterized protein (characterized, see rationale)
to candidate 8499631 DvMF_0397 protein of unknown function DUF224 cysteine-rich region domain protein (RefSeq)
Query= uniprot:E4PLR5 (279 letters) >FitnessBrowser__Miya:8499631 Length = 253 Score = 268 bits (684), Expect = 1e-76 Identities = 129/248 (52%), Positives = 167/248 (67%), Gaps = 1/248 (0%) Query: 25 YPEKPEAVTLFGTCVVDLFFPEAGLDTIRLLEREGVRVHFPQEQSCCGQPAWTSGYRDEA 84 YP + V FGTC+VD+ FP+AG+ I LL R GV V FPQEQSCCGQPA+ SG+ +EA Sbjct: 7 YPRDVKTVYYFGTCLVDMSFPQAGMAGIHLLRRAGVEVVFPQEQSCCGQPAYNSGFLEEA 66 Query: 85 KAVARAQLDILDRSGLPVVVPSGSCAGMFRHHYPALFADEPDTLKRVEALAERTFELTEF 144 KAVARAQ+ R+ P+VVPSGSCAGM RHHYP +FA++P+ V +ER FEL +F Sbjct: 67 KAVARAQIKAFSRADWPIVVPSGSCAGMMRHHYPEMFANDPEYFD-VRKFSERVFELGDF 125 Query: 145 LLKVCRVQLADRGAPSKIALHTSCSARREMNTHLHARELLQQLEGVERIDHDHESECCGF 204 L V+ D+G P K+ H+SC A REM A+ L+ QL VE ++ + E ECCGF Sbjct: 126 LHNALHVRYEDKGKPVKVTWHSSCHAMREMGATAAAKALIGQLSNVELVEIEREYECCGF 185 Query: 205 GGTFSVRMPEVSGAMVKDKTRSLIDSGAVEMVTADGGCLMNINGSLEKQKESFRGRHLAS 264 GGTFS++ PE+S AMV DK + +GA +++ D GCLMNI G++E + RHLA Sbjct: 186 GGTFSIKQPEISAAMVADKVEDIRATGASAILSGDCGCLMNIGGAMEHKGVPVAPRHLAE 245 Query: 265 FLWERTNG 272 F+WER NG Sbjct: 246 FIWERING 253 Lambda K H 0.320 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 253 Length adjustment: 25 Effective length of query: 254 Effective length of database: 228 Effective search space: 57912 Effective search space used: 57912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory