Align NgcF, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate 8499892 DvMF_0657 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= TCDB::Q8RJU9 (308 letters) >FitnessBrowser__Miya:8499892 Length = 297 Score = 145 bits (365), Expect = 1e-39 Identities = 95/297 (31%), Positives = 155/297 (52%), Gaps = 26/297 (8%) Query: 3 HGKYRFIVGFLAV--PLGLYALLVVWPFIQSIYYSF-TDWTGLSPDFKTVGFDNYERMLD 59 H R I +L + L A +P + + +SF D G +P + VG ++Y+ +L+ Sbjct: 8 HATMRTIHAWLLLLPALAFIAAFTHYPAVNTFIHSFFLDGRGGAPA-QFVGLEHYQYLLE 66 Query: 60 DDIFWKSLQHSLLFALLLPVVTIGLALFFAFMINVGGRRRRGGPVITGVRGSGFYKIVYF 119 D++F K+L ++LLFA ++IGLA+ AF++N G + G ++ YF Sbjct: 67 DEVFRKALVNNLLFASGTIPLSIGLAMTMAFLVNAG------------LAGQSVLRLCYF 114 Query: 120 FPQVLSIAIVALLFAFAYNPDSGAINSLLRGIGLGDVQPVWLGDPDLALWCVMAVIVWST 179 P VL + VA ++ F Y P+ G + + +GL V WLG AL CV+AV VW Sbjct: 115 VPTVLPMIAVANIWLFFYTPEYGLLEQIRGALGLAGVN--WLGSESTALPCVIAVAVWKD 172 Query: 180 VGFFVVLFSAGMASIPADIYEAALLDGANRVTTFFRITLPLLWDTVQSGWVYMGILALGA 239 GFF++ + A + IP + EAA+L+GA+R+ + R+ +PLL T V I A Sbjct: 173 AGFFMIFYLAALQQIPPSLGEAAMLEGASRLYYYRRVVIPLLMPTTLFVLVNATINAFR- 231 Query: 240 ESFAVVHIMTTGPGGPDYSTTVMVLYVYQKAFRDGQAAYATTIGVALLIVTLAFAAV 296 V H+ GGP+ ++++++ Y+Y+ +F+ Y G AL +V L F A+ Sbjct: 232 ---MVDHLFVLTQGGPNNASSLLLYYIYEVSFKYWDTGY----GAALTMVLLGFLAL 281 Lambda K H 0.330 0.145 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 297 Length adjustment: 27 Effective length of query: 281 Effective length of database: 270 Effective search space: 75870 Effective search space used: 75870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory