Align NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate 8499893 DvMF_0658 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= TCDB::Q8RJU8 (307 letters) >FitnessBrowser__Miya:8499893 Length = 277 Score = 139 bits (351), Expect = 6e-38 Identities = 86/263 (32%), Positives = 144/263 (54%), Gaps = 9/263 (3%) Query: 45 ILVLWAFMVVLPLLWAVMTSFKDDASIFGSPWSLPDKLHFDNWSRAWTEAHMGDYFLNTV 104 + VLWA LPLL+AV T+F S F + ++L L DN+ AW A Y +NTV Sbjct: 24 LAVLWA----LPLLYAVWTAFHP--SEFSTRFTLAAPLTLDNFRAAWDAAPFARYLVNTV 77 Query: 105 LVVGGSLIGTLVLGSMAAYVLARFDFPGNRFIYYLFIGGMSFPIMLALVPLFYVVNNMGL 164 L+V L G LVL ++AAY A++DFPG ++ L + + + +V + ++ +G+ Sbjct: 78 LLVTMVLAGQLVLCTLAAYAFAKYDFPGKGILFALVLMQLMIMPDVLVVENYRTMSAIGV 137 Query: 165 LNTLHGLILVYIAYSLPFTVFFLTAFFRTLPSSVAEAAFVDGASHTRTFFQIMLPMAKPG 224 L++ + L Y+A + F +F L F+++P + EAA V+GAS + +++ +P+ KP Sbjct: 138 LDSTLAIGLPYMASA--FGIFLLRQTFKSIPKELDEAAAVEGASTLQILWKVYVPLGKPV 195 Query: 225 LISVGIFNFLGQWNQYMLPTVLNTDPDKRVLTQGLVQLAVSQGYKGDWSGLFAGLVMAML 284 ++ + + WN ++ P ++ + R LT GL Q+ S DWS + A +M Sbjct: 196 YLAYALVSVSYHWNNFLWPLIVTNTTNSRPLTVGL-QVFSSTEQGVDWSIITAATLMTSG 254 Query: 285 PVLAAYIIFQRQVVQGLTAGALK 307 P+L +++FQRQ VQ +K Sbjct: 255 PLLIGFLLFQRQFVQSFMRAGIK 277 Lambda K H 0.326 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 277 Length adjustment: 26 Effective length of query: 281 Effective length of database: 251 Effective search space: 70531 Effective search space used: 70531 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory