GapMind for catabolism of small carbon sources

 

Aligments for a candidate for araVsh in Desulfovibrio vulgaris Miyazaki F

Align ABC transporter related (characterized, see rationale)
to candidate 8502321 DvMF_3029 ABC transporter related (RefSeq)

Query= uniprot:A0KWY5
         (499 letters)



>lcl|FitnessBrowser__Miya:8502321 DvMF_3029 ABC transporter related
           (RefSeq)
          Length = 537

 Score =  228 bits (581), Expect = 4e-64
 Identities = 147/472 (31%), Positives = 258/472 (54%), Gaps = 13/472 (2%)

Query: 4   ILELKQISKHYPGVKALEDVSLRLFAGEVHALLGENGAGKSTLVKVMTGAQSKDMGDILF 63
           ++ L  I K +  V+A  D++L +  G + ALLGENGAGKSTL+ ++ G   +D G I+ 
Sbjct: 29  VVRLDGICKSFGKVRANHDITLDIRPGCIKALLGENGAGKSTLMSILAGKLRQDAGTIVV 88

Query: 64  LGEPQHFNTPMDAQKAGISTVYQEVNLVPNLTVAQNLFLGYEPRRLGLIHFKKMYADARA 123
            G P  F +P DA +AGI  VYQ   LV ++TVA+N+ LG  P    L+   +M  +  A
Sbjct: 89  DGVPTVFASPRDALRAGIGMVYQHFMLVDSMTVAENVLLGQSPDM--LLRPARMRDEVAA 146

Query: 124 VLTQFKLDIDVSAPLSDYSIAVQQLIAIARGVAMSAKVLVLDEPTASLDAKEVQVLFGIL 183
           +  ++ L +D +A +   S+  +Q + I + +   ++VL+LDEPTA L  +E   LF  +
Sbjct: 147 LAERYGLAVDPAARVGGLSMGERQRVEILKLLYRDSRVLILDEPTAVLTPRETDQLFEAM 206

Query: 184 NQLKAKGVAIVFITHFLDQVYQISDRITVLRNGQFIGEYLTAELP-QPKLIEAMLGRSLQ 242
            ++  +G A+VFI+H L +V  ++D I +LR G+ + E+  A++P Q  L   M+GR + 
Sbjct: 207 WRMADQGKALVFISHKLQEVLTVADEIAILRRGEVVDEFSEADVPNQTVLANRMVGRDVV 266

Query: 243 EQLVDKQEKERTVTRAEAVLLSLEDVSVKGSIQSMNLTVPKGQAVGLAGLLGSGRSEVCN 302
            Q+  K+     +T  + V LS+E +S  G +  ++L V +G+ V +AG+ G+G+ E+  
Sbjct: 267 LQVDAKR-----LTPVDTV-LSVEHLSGAG-LSDVSLQVRRGEIVAIAGVAGNGQKELVE 319

Query: 303 AVFGLDLVDSGSIHLAGQKLNLSQPVDAISAGIALCPEDRKIDGIIGPLSIRENIILALQ 362
           A+ GL   ++G + + G+             G+A  PEDR+       L + +N +L  +
Sbjct: 320 AICGLARPEAGEVRILGRPWREFFAGPPGRRGLAYIPEDRQGLATCRHLDLVDNFLLTTR 379

Query: 363 ARIGWWRYLSNTRQQEIAQFFIDKLQIATPDADKPIEQLSGGNQQKVILARWLAIEPILL 422
            +     +L  T      +  + +  +   D   P   LSGGN QK+++ R    +P ++
Sbjct: 380 NQFAKGVFLDRTEATNAVKRVVWEYNVQPGDITAPARALSGGNLQKLVIGREFFRKPEVI 439

Query: 423 VLDEPTRGIDIGAHAEI-VKLIRTLCDEGMSLLVASSELDELVAFSNKVVVL 473
           V + PT+G+DI A  E+  +L+      G  +L+ + +L+E +  ++++ V+
Sbjct: 440 VAENPTQGLDISATEEVWGRLLEARSTSG--VLLVTGDLNEALELADRIAVM 489



 Score = 66.6 bits (161), Expect = 2e-15
 Identities = 56/239 (23%), Positives = 114/239 (47%), Gaps = 11/239 (4%)

Query: 255 VTRAEAVLLSLEDVSVKGSIQSMNLTVPKGQAVGLAGLLGSGRSEVCNAVFGLDLVDSGS 314
           V R + +  S   V     I    L +  G    L G  G+G+S + + + G    D+G+
Sbjct: 29  VVRLDGICKSFGKVRANHDI---TLDIRPGCIKALLGENGAGKSTLMSILAGKLRQDAGT 85

Query: 315 IHLAGQKLNLSQPVDAISAGIALCPEDRKIDGIIGPLSIRENIILALQARIGWWRYLSNT 374
           I + G     + P DA+ AGI +  +   +   +  +++ EN++L     +     L   
Sbjct: 86  IVVDGVPTVFASPRDALRAGIGMVYQHFML---VDSMTVAENVLLGQSPDM----LLRPA 138

Query: 375 RQQEIAQFFIDKLQIATPDADKPIEQLSGGNQQKVILARWLAIEPILLVLDEPTRGIDIG 434
           R ++      ++  +A   A + +  LS G +Q+V + + L  +  +L+LDEPT  +   
Sbjct: 139 RMRDEVAALAERYGLAVDPAAR-VGGLSMGERQRVEILKLLYRDSRVLILDEPTAVLTPR 197

Query: 435 AHAEIVKLIRTLCDEGMSLLVASSELDELVAFSNKVVVLRDRYAVRELSGAELTSQHVM 493
              ++ + +  + D+G +L+  S +L E++  ++++ +LR    V E S A++ +Q V+
Sbjct: 198 ETDQLFEAMWRMADQGKALVFISHKLQEVLTVADEIAILRRGEVVDEFSEADVPNQTVL 256



 Score = 64.3 bits (155), Expect = 1e-14
 Identities = 58/219 (26%), Positives = 103/219 (47%), Gaps = 18/219 (8%)

Query: 12  KHYPGVKALEDVSLRLFAGEVHALLGENGAGKSTLVKVMTGAQSKDMGDILFLGEP--QH 69
           +H  G   L DVSL++  GE+ A+ G  G G+  LV+ + G    + G++  LG P  + 
Sbjct: 284 EHLSGA-GLSDVSLQVRRGEIVAIAGVAGNGQKELVEAICGLARPEAGEVRILGRPWREF 342

Query: 70  FNTP--------MDAQKAGISTVYQEVNLVPN-LTVAQNLFLGYEPRRLGLIHFKKMYAD 120
           F  P        +   + G++T  + ++LV N L   +N F     + + L   +   A 
Sbjct: 343 FAGPPGRRGLAYIPEDRQGLATC-RHLDLVDNFLLTTRNQFA----KGVFLDRTEATNAV 397

Query: 121 ARAVLTQFKLDIDVSAPLSDYSIAVQQLIAIARGVAMSAKVLVLDEPTASLDAKEVQVLF 180
            R V        D++AP    S    Q + I R      +V+V + PT  LD    + ++
Sbjct: 398 KRVVWEYNVQPGDITAPARALSGGNLQKLVIGREFFRKPEVIVAENPTQGLDISATEEVW 457

Query: 181 GILNQLKAKGVAIVFITHFLDQVYQISDRITVLRNGQFI 219
           G L + ++    ++ +T  L++  +++DRI V+  G+FI
Sbjct: 458 GRLLEARSTS-GVLLVTGDLNEALELADRIAVMYRGRFI 495


Lambda     K      H
   0.319    0.136    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 622
Number of extensions: 39
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 3
Length of query: 499
Length of database: 537
Length adjustment: 35
Effective length of query: 464
Effective length of database: 502
Effective search space:   232928
Effective search space used:   232928
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory