Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate 8501168 DvMF_1902 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding (RefSeq)
Query= curated2:A1RYE4 (339 letters) >FitnessBrowser__Miya:8501168 Length = 301 Score = 156 bits (395), Expect = 5e-43 Identities = 98/258 (37%), Positives = 136/258 (52%), Gaps = 14/258 (5%) Query: 56 TDKIDAEVMDAAPNLKVISTYSVGFDHIDIPEATKRGIYVTHTPGVLTDAVAEFTVGLIL 115 T+ + VM A P LKVIS G D +D A + GI V +TP T AVAE T+G L Sbjct: 56 TEPLTRRVMQALPELKVISRCGTGMDSVDRAAAAELGIAVRNTPDAPTLAVAELTLGYAL 115 Query: 116 AVTRRIVEADKIIRTGQWDKPWNPYFLTGPELKGKTIGLVGLGRIGVATAKRLSSFDVKI 175 + R + D+ +R G W K G L GK +GL+G GRIG AT K +F ++ Sbjct: 116 DLMRLVSRMDRELRAGTWKKRM------GNLLAGKKVGLIGFGRIGRATGKLFEAFGCEV 169 Query: 176 LYYDIERRWDVETVIPNMEFTDLDTLLEKSDIVSIHVPLTKETYHLINEERLRKMKKTAY 235 + D D + ++D LL +DIVS+H + ++++E RL M+ + Sbjct: 170 AFADPFAESDTNARM------EVDALLAWADIVSLHCSKPEGGGYILDEHRLGLMRPGTW 223 Query: 236 LINTARGPVVDTEALVKALKEGWIAGAALDVFEQEPLPPNHPLTKFDNVVLAPHIASATI 295 +IN ARG ++D AL L G +AGAALDVF +EP PL NV+L PH+ S + Sbjct: 224 VINAARGGLIDEAALHALLASGHLAGAALDVFAKEPY--EGPLRDLPNVILTPHVGSYAV 281 Query: 296 EARQRMAELAARNLIAVL 313 EAR +M RNL+ L Sbjct: 282 EARVKMETDTIRNLLDAL 299 Lambda K H 0.319 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 301 Length adjustment: 28 Effective length of query: 311 Effective length of database: 273 Effective search space: 84903 Effective search space used: 84903 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory